[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31079.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  192/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->216 1oy1D PDBj 1e-40 52.2 %
:RPS:PDB   3->215 3cyfA PDBj 6e-09 16.4 %
:RPS:SCOP  3->216 1oy1A  c.23.16.2 * 1e-76 45.0 %
:HMM:SCOP  1->219 1oy1A_ c.23.16.2 * 2.2e-48 33.8 %
:HMM:PFM   79->204 PF01965 * DJ-1_PfpI 1.6e-18 28.3 113/148  
:BLT:SWISS 1->216 ELBB_SHIFL 2e-48 51.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31079.1 GT:GENE ACD31079.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1287576..1288235) GB:FROM 1287576 GB:TO 1288235 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31079.1 GB:DB_XREF GI:187712782 LENGTH 219 SQ:AASEQ MAKVAVVLSGCGYLDGSEIHETVLTILALEKQGVEWQGVALNRDQKQVINHLHQSVDSKASPRNILEESARITRGNVIDIADADSDDYDAIIFPGGFGAAKNIMDFAFVGDDSYQMDEEVLKFARAFYLADKPAGYICIAPLMIPLVYPEGTKATVGTDENTTAILAKKGAEAIIMDATDICVDESVKIVSTPAYMCARNILEAAQGIEKLVEKVVSYI GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 1->216|ELBB_SHIFL|2e-48|51.6|213/217| SEG 78->92|idiadadsddydaii| BL:PDB:NREP 1 BL:PDB:REP 3->216|1oy1D|1e-40|52.2|205/210| RP:PDB:NREP 1 RP:PDB:REP 3->215|3cyfA|6e-09|16.4|177/185| HM:PFM:NREP 1 HM:PFM:REP 79->204|PF01965|1.6e-18|28.3|113/148|DJ-1_PfpI| RP:SCP:NREP 1 RP:SCP:REP 3->216|1oy1A|1e-76|45.0|211/221|c.23.16.2| HM:SCP:REP 1->219|1oy1A_|2.2e-48|33.8|216/221|c.23.16.2|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 293 OP:NHOMOORG 239 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------111-------------------------------------11111111--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111111-----------------1111----------------------------------------------------1------------------------1---1----1-----1111111111111--1----------------------------11-1--11-1-1111111111111111111-------------111111-1111111111-1111111111111111111111111111111111111111111111111111-11111111-111---1-----------1-------------------11------1-11111111111111111111111111-1--11111121-11----------------1--------------------------------------------1----------- ------1-----------------------------------------------------------------------------------------------------2114622631---11111-217C2-312-1111111--11--11-2143241--121--------22------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 98.2 SQ:SECSTR ##EEEEEEccccTcTTccHHHHHHHHHHHHHTTcEEEEEETTccccEEcTTccEEcccEEHHHHHTTccccEETTccEEGGGccGGGccEEEEcccHHHHHHHHHcHHHGGGc#cccHHHHHHHHHHHHTTcEEEEETTTHHHHHTTccTTcEEcccccGGGHHHHHTTcccEEccccEETTEEEEccGGGHHHHHHHHHHHHHcHHHHHHHHGGGcc# DISOP:02AL 218-220| PSIPRED ccEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccEEEccHHHHccccccHHHccHHHccEEEEcccccccHHHHHHHHccccHHHccHHHHHHHHHHHHccccEEEEEcHHHHHHHHHccccEEEEcccHHHHHHHHHcccEEEEccccEEEEcccccEEcccHHHccccHHHHHHHHHHHHHHHHHHc //