[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31086.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:RPS:PFM   7->139 PF08897 * DUF1841 6e-32 46.6 %
:HMM:PFM   5->138 PF08897 * DUF1841 2.7e-53 43.3 134/137  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31086.1 GT:GENE ACD31086.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1293491..1293919 GB:FROM 1293491 GB:TO 1293919 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31086.1 GB:DB_XREF GI:187712789 LENGTH 142 SQ:AASEQ MILSQDRYQLRKLFIDSWNKFVNNTPLTALEEQIARIIELHPEYHKQITLENIDKDYLPEAGQINPFWHISLHLAIIEQIQTNRPFGISNVYQQLLGKYNNEHKVHHIMIDYLAEEMWKSQKYNTLPDEQNYLTKLQELTLI GT:EXON 1|1-142:0| RP:PFM:NREP 1 RP:PFM:REP 7->139|PF08897|6e-32|46.6|133/136|DUF1841| HM:PFM:NREP 1 HM:PFM:REP 5->138|PF08897|2.7e-53|43.3|134/137|DUF1841| OP:NHOMO 88 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111-11111111-11112111111-1111111111---------------------------------------------------------11---------------------------------11-1--------------------------------------------------------------------------------------------------1111-------------------------------------------------1111111111--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHccHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcc //