[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31088.1
DDBJ      :             conserved hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  263/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->222 PF01027 * UPF0005 2e-11 34.6 %
:HMM:PFM   24->221 PF01027 * UPF0005 8.9e-53 41.8 194/203  
:BLT:SWISS 25->226 Y2604_PSEAE 2e-43 42.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31088.1 GT:GENE ACD31088.1 GT:PRODUCT conserved hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1295294..1295980 GB:FROM 1295294 GB:TO 1295980 GB:DIRECTION + GB:PRODUCT conserved hypothetical membrane protein GB:PROTEIN_ID ACD31088.1 GB:DB_XREF GI:187712791 LENGTH 228 SQ:AASEQ MNNLQNNTRVIDSLSQESVLRANKVLRNTYWLLSMTLLFSAFTAFIAMSTGATIMNPLLMLVVYIGLLFGINATKNSPWGIVLTFALTGLLGYSLGPILNMYLTMFKNGAELIMMAFGTTGLIFLGLSVVAMSPARNFNRLGSFCAIGAIVALVALVINIFLQLPALALVISLVFAFISGGFILWQTNAIVRGEETNYILATVNIYVSLFNIFVTLLQIFGAVAGDRE GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 25->226|Y2604_PSEAE|2e-43|42.8|201/222| TM:NTM 7 TM:REGION 21->43| TM:REGION 51->73| TM:REGION 80->102| TM:REGION 112->134| TM:REGION 140->162| TM:REGION 168->190| TM:REGION 200->222| SEG 146->162|aigaivalvalvinifl| RP:PFM:NREP 1 RP:PFM:REP 26->222|PF01027|2e-11|34.6|191/200|UPF0005| HM:PFM:NREP 1 HM:PFM:REP 24->221|PF01027|8.9e-53|41.8|194/203|UPF0005| OP:NHOMO 271 OP:NHOMOORG 268 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111211111-1111121111111111111111211--------------------------------1111111111-1-1111111--1-11111--11111111111111111111111111--11111------11111111111111111-111111111111111111111111---11111111111111111111111111---------------------111111111111111111111111----------1111111111111111111111111111-11111111111111--------------11--------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------1-------11----------------------1------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 228-229| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //