[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31092.1
DDBJ      :             transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->64 1y7yB PDBj 8e-06 32.1 %
:RPS:PDB   11->75 2axuG PDBj 2e-09 17.5 %
:RPS:SCOP  11->64 2icpA1  a.35.1.3 * 2e-08 13.0 %
:HMM:SCOP  5->63 1x57A1 a.35.1.12 * 2.4e-09 32.2 %
:RPS:PFM   15->64 PF01381 * HTH_3 2e-04 34.0 %
:HMM:PFM   15->63 PF01381 * HTH_3 1e-11 30.6 49/55  
:BLT:SWISS 1->68 Y4MF_RHISN 1e-13 47.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31092.1 GT:GENE ACD31092.1 GT:PRODUCT transcriptional regulator GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1307899..1308126 GB:FROM 1307899 GB:TO 1308126 GB:DIRECTION + GB:PRODUCT transcriptional regulator GB:PROTEIN_ID ACD31092.1 GB:DB_XREF GI:187712795 LENGTH 75 SQ:AASEQ MQKNIFNTKDLGLLIRKARKKQGLTQADLSGISGLGTRFIGEVENGKNTAHIGKVIQLASSLGLVISVGCDWMED GT:EXON 1|1-75:0| BL:SWS:NREP 1 BL:SWS:REP 1->68|Y4MF_RHISN|1e-13|47.1|68/76| BL:PDB:NREP 1 BL:PDB:REP 12->64|1y7yB|8e-06|32.1|53/66| RP:PDB:NREP 1 RP:PDB:REP 11->75|2axuG|2e-09|17.5|63/299| RP:PFM:NREP 1 RP:PFM:REP 15->64|PF01381|2e-04|34.0|50/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 15->63|PF01381|1e-11|30.6|49/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 11->64|2icpA1|2e-08|13.0|54/87|a.35.1.3| HM:SCP:REP 5->63|1x57A1|2.4e-09|32.2|59/0|a.35.1.12|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 27 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --1-----111---------------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------11------------------1----------------1---1---------1-----------------------------------------------------------------------------------------1--------------------1-----------------------------------------------11------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHHHHHHTccHHHHcHHTTTcHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHTTTc DISOP:02AL 75-76| PSIPRED cccccccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHccEEEEccccccc //