[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31095.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->57 PF03450 * CO_deh_flav_C 0.00039 26.7 45/103  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31095.1 GT:GENE ACD31095.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1310705..1310965) GB:FROM 1310705 GB:TO 1310965 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31095.1 GB:DB_XREF GI:187712798 LENGTH 86 SQ:AASEQ MSDTSTDLQNGFDFAGLAASMALAAKNNEFTMATAAFIGMLNEPVKAYNSAKAFSTGAKSFDSIVFGMDLGLVQGEAIAQAMMQEV GT:EXON 1|1-86:0| SEG 15->25|aglaasmalaa| HM:PFM:NREP 1 HM:PFM:REP 11->57|PF03450|0.00039|26.7|45/103|CO_deh_flav_C| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-31,39-39,67-67,73-73,76-76,86-87| PSIPRED ccccHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //