[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31100.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.250.1
:248 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   15->173 1vlyA PDBj 2e-07 34.6 %
:RPS:SCOP  13->179 1nrkA2  d.250.1.1 * 1e-32 32.3 %
:HMM:SCOP  1->182 1nrkA2 d.250.1.1 * 8.7e-33 36.4 %
:RPS:PFM   3->151 PF01571 * GCV_T 8e-11 31.8 %
:HMM:PFM   4->128 PF01571 * GCV_T 5.5e-20 34.1 123/211  
:BLT:SWISS 8->245 Y466_HAEIN 7e-18 27.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31100.1 GT:GENE ACD31100.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1318641..1319387) GB:FROM 1318641 GB:TO 1319387 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31100.1 GB:DB_XREF GI:187712803 LENGTH 248 SQ:AASEQ MTFQYINFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLLLSVEQEVFENLLAWLKKYGMFSKVSFNPNDDYALFFTKTGFLNHDILTKGSLTSEMTFEQVRKENIINKLATINAANFEKFLPAELDLDNVDKVVCYTKGCYMGQEVIARMHYKAKLKKELAVVKSESDIDDFDLKDSEGKPLANVVNKVFVDNQCYMLVVFHKEASEQEYQLDDGKIITKC GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 8->245|Y466_HAEIN|7e-18|27.4|234/280| SEG 180->193|kaklkkelavvkse| BL:PDB:NREP 1 BL:PDB:REP 15->173|1vlyA|2e-07|34.6|153/314| RP:PFM:NREP 1 RP:PFM:REP 3->151|PF01571|8e-11|31.8|148/211|GCV_T| HM:PFM:NREP 1 HM:PFM:REP 4->128|PF01571|5.5e-20|34.1|123/211|GCV_T| GO:PFM:NREP 3 GO:PFM GO:0004047|"GO:aminomethyltransferase activity"|PF01571|IPR006222| GO:PFM GO:0005737|"GO:cytoplasm"|PF01571|IPR006222| GO:PFM GO:0006546|"GO:glycine catabolic process"|PF01571|IPR006222| RP:SCP:NREP 1 RP:SCP:REP 13->179|1nrkA2|1e-32|32.3|164/243|d.250.1.1| HM:SCP:REP 1->182|1nrkA2|8.7e-33|36.4|176/243|d.250.1.1|1/1|Folate-binding domain| OP:NHOMO 31 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------1111---111--111-1111111111-------------------111111111-1-------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 61.3 SQ:SECSTR ##############cTTHHHH#HTTccccGG##GcTTcEEEEEEEcTTccEEEEEE##EEETTEEEEEEEHHHHHHHHHHHHTTccccccEEEEEcccEETccccccTTccEEEETTEEcHHHHHHHcTTHHHHTcccccGGGTTcccGGGGTGGGTTc#ccccccccTTHH############################################################################ PSIPRED cEEEccccEEEEEEcccHHHHHHHHccccHHHccccccEEEEEEEcccccEEEEEEEEEEcccEEEEEEcHHHHHHHHHHHHHHHHHHcEEEEEccccEEEEEcccccccHHHccccccccccHHHccHHHHHccccccccccHHHHHHHHccHHHHccEEEEccccccHHHHHHHHcccccccEEEEEEEcccccccccHHHcccEEEEEEEEEEEEccEEEEEEEEEcccccccEEEccccEEEcc //