[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31102.1
DDBJ      :             isochorismatase hydrolase family protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->148 3eefA PDBj 1e-07 31.2 %
:RPS:PDB   3->158 3eefA PDBj 1e-24 20.8 %
:RPS:SCOP  2->158 1nf8A  c.33.1.3 * 1e-25 17.4 %
:HMM:SCOP  1->159 1x9gA_ c.33.1.3 * 8e-27 33.3 %
:RPS:PFM   5->152 PF00857 * Isochorismatase 3e-15 32.9 %
:HMM:PFM   5->156 PF00857 * Isochorismatase 1.3e-24 31.3 150/174  
:BLT:SWISS 78->137 ISC1B_DICDI 7e-10 45.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31102.1 GT:GENE ACD31102.1 GT:PRODUCT isochorismatase hydrolase family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1321200..1321688 GB:FROM 1321200 GB:TO 1321688 GB:DIRECTION + GB:PRODUCT isochorismatase hydrolase family protein GB:PROTEIN_ID ACD31102.1 GB:DB_XREF GI:187712805 LENGTH 162 SQ:AASEQ MSKNALVIIDVQNYFVNEHTKTLPQKIRKLIQTNDFNYIIFSKYVNNLKSNHYNIFKWEECQNSPDIDIHPELLEFTNSKNVFEKNTYSIFKSTMLNFLKQKNINKIYLTGIDIDACVLASAFDGFDLGYDIEILQDFCLSHFGEEFKHSALKIMHKNLICQ GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 78->137|ISC1B_DICDI|7e-10|45.0|60/206| BL:PDB:NREP 1 BL:PDB:REP 3->148|3eefA|1e-07|31.2|141/168| RP:PDB:NREP 1 RP:PDB:REP 3->158|3eefA|1e-24|20.8|154/168| RP:PFM:NREP 1 RP:PFM:REP 5->152|PF00857|3e-15|32.9|140/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 5->156|PF00857|1.3e-24|31.3|150/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 2->158|1nf8A|1e-25|17.4|155/207|c.33.1.3| HM:SCP:REP 1->159|1x9gA_|8e-27|33.3|138/192|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 22 OP:NHOMOORG 16 OP:PATTERN ----1--------------------------------------------------------1------ ------------------------------------------------------------1-------1-----------------1----------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22212212--------------------------------------------------------------------1------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 99.4 SQ:SECSTR #TcEEEEEEccHHHHTcTTccHHHHHHHHHHHHHHHTTcEEEEEEcccTTcTTHHHHccccTTcGGGcccGGGcccTTcEcEEEEccccTTTTccHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHTTcEEEEEEEEEcEccccTTHHHHHHHHHccHHcH DISOP:02AL 162-163| PSIPRED ccccEEEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHcccccHHHHHHHHHccccccEEEEccccccccHHHHHHHHHccccEEEEEEEEHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHHHcccc //