[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31109.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->52 PF12420 * DUF3671 0.00064 25.5 51/104  
:BLT:SWISS 48->103 YCX1_ASTLO 5e-04 30.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31109.1 GT:GENE ACD31109.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1331481..1331816) GB:FROM 1331481 GB:TO 1331816 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31109.1 GB:DB_XREF GI:187712812 LENGTH 111 SQ:AASEQ MKKKSLFLFLFLIILTAIVLVLFYRLAQWYEQIMGTIFSYIMMIGFILFIFAPFRFIKDKKANISFFNYFKYMGMTLLALAKIIINICKQAVLTVGYVVTRLFANDQSQDK GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 48->103|YCX1_ASTLO|5e-04|30.4|56/100| TM:NTM 3 TM:REGION 5->27| TM:REGION 33->55| TM:REGION 77->99| SEG 6->23|lflflfliiltaivlvlf| HM:PFM:NREP 1 HM:PFM:REP 2->52|PF12420|0.00064|25.5|51/104|DUF3671| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-32,34-34,39-40,45-45,48-48,53-53| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccc //