[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31116.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->67 PF00841 * Protamine_P2 0.00088 16.1 62/91  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31116.1 GT:GENE ACD31116.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1341814..1342167 GB:FROM 1341814 GB:TO 1342167 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31116.1 GB:DB_XREF GI:187712819 LENGTH 117 SQ:AASEQ MSKCKTHQNHEHKHQDDCGHTKIKHGDHYDYLHDGHLHHEHNGHYDEHTLEVIEKNPDGCHPIKEDCSSHVHGPNCGHEAVPHGDHIDYIVDGRLHHPHGDHCDDHGPVEVIKNDKK GT:EXON 1|1-117:0| SEG 25->48|hgdhydylhdghlhhehnghydeh| SEG 96->108|hhphgdhcddhgp| HM:PFM:NREP 1 HM:PFM:REP 5->67|PF00841|0.00088|16.1|62/91|Protamine_P2| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- --1----------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1-------------------------------11---------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 117-118| PSIPRED cccccccccccccccccccccccccccccHHHHcccccHHHcccccHHHHHHHHcccccccccccHHHHccccccccccccccccccHHHccccccccccccccccccEEEcccccc //