[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31122.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  367/915 : Eukaryota  85/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->118 2d2aA PDBj 2e-14 34.6 %
:RPS:PDB   6->118 2d2aA PDBj 1e-24 31.2 %
:RPS:SCOP  13->105 1r94A  b.124.1.1 * 2e-16 29.3 %
:HMM:SCOP  11->108 1r94A_ b.124.1.1 * 4.9e-19 36.1 %
:RPS:PFM   13->104 PF01521 * Fe-S_biosyn 3e-09 33.0 %
:HMM:PFM   13->93 PF01521 * Fe-S_biosyn 3.7e-22 29.6 81/91  
:BLT:SWISS 13->118 ISCA_HAEIN 1e-18 42.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31122.1 GT:GENE ACD31122.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1353551..1353907) GB:FROM 1353551 GB:TO 1353907 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31122.1 GB:DB_XREF GI:187712825 LENGTH 118 SQ:AASEQ MVEVFDPNASSILEVTDAAAKHFKKHLDKHDGCIGIYVGTKVMGCSGLAYDVDFVKQQPQDTQKVQQHGINFFVSNKSMDFLNGLKIDYVKHDFGLYKLEYTNPNESARCGCGESFTV GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 13->118|ISCA_HAEIN|1e-18|42.3|104/107| SEG 55->67|vkqqpqdtqkvqq| BL:PDB:NREP 1 BL:PDB:REP 13->118|2d2aA|2e-14|34.6|104/114| RP:PDB:NREP 1 RP:PDB:REP 6->118|2d2aA|1e-24|31.2|112/114| RP:PFM:NREP 1 RP:PFM:REP 13->104|PF01521|3e-09|33.0|91/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 13->93|PF01521|3.7e-22|29.6|81/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 13->105|1r94A|2e-16|29.3|92/97|b.124.1.1| HM:SCP:REP 11->108|1r94A_|4.9e-19|36.1|97/97|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 547 OP:NHOMOORG 453 OP:PATTERN ------------------------------1------------------------------------- -------------------------------------------1------------------------------------------------------------------------------------------1----------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11------1-11-111111122222222222-11-111111--1------------1-111----------11111111-----111---11-----111111111111111111111111111111111111111111111111111122111111111211111212111111111111111111111111---------------------------------------------------------1111111111111111111111111111-1111--11111-----12121212222222222-2222222222222112212222222222222222222222222222122221122222222222211-1111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111----111-------------------------------------------------------- ----11-----------11------------------------1-1--1-11-1----11111---11--1----------111-----------------------1112-1111--1111112111-231-111111-1111111--111-1-111-11111-1-111---1-111-----112-11---1-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 95.8 SQ:SECSTR #####ccccccccEEcHHHHHHHHHHHHHcTTccEEEEEEEEETTTEEEEEEEEEccccTTEEEEEETTEEEEEEGGGHHHHTTcEEEEEEETTETEEEEEEcTTTcccccccccccc DISOP:02AL 118-119| PSIPRED ccEEEcccccccEEEcHHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEccccccccccEEEEEccEEEEEcHHHHHHHHccEEEEEEccccccEEEEEcccccccccccccccc //