[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31131.1
DDBJ      :             integral membrane protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  113/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:340 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   48->338 PF04332 * DUF475 1e-54 47.8 %
:HMM:PFM   48->337 PF04332 * DUF475 3.6e-97 43.6 287/294  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31131.1 GT:GENE ACD31131.1 GT:PRODUCT integral membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1363923..1364945 GB:FROM 1363923 GB:TO 1364945 GB:DIRECTION + GB:PRODUCT integral membrane protein GB:PROTEIN_ID ACD31131.1 GB:DB_XREF GI:187712834 LENGTH 340 SQ:AASEQ MKILKYFYGSFFVTLIGIVIAVFIYPNAPLETIYSVLILAILEISLSFDNAVINAKILGQMSPRWQKIFIYIGLPIAVFGMRLLFPILLVSVTSGINFMNVVTLALDNPQQYQAILEHSMPYICSFGGSFLLMVFLNFFLSENKGHHWIPLIENNIITKKIRNYDGGYILLAVIIGVITIYYSDPNYQGSLAIAFLLGIVVHESIGLLNSLFDTAKVSTTDVARNGLIGFIYLEIIDASFSFDGVIGAFAITANIIIIMIGLGIGAMFVRSLTILFVEKKTLAKYIYLEHGAHYAIGFLAAVLLLKIFMHIPEWFSGSIGILVLTLAFIHSVISHKKLHN GT:EXON 1|1-340:0| TM:NTM 9 TM:REGION 1->23| TM:REGION 27->49| TM:REGION 76->98| TM:REGION 122->144| TM:REGION 162->182| TM:REGION 193->215| TM:REGION 226->248| TM:REGION 252->274| TM:REGION 303->325| SEG 246->266|igafaitaniiiimiglgiga| RP:PFM:NREP 1 RP:PFM:REP 48->338|PF04332|1e-54|47.8|289/293|DUF475| HM:PFM:NREP 1 HM:PFM:REP 48->337|PF04332|3.6e-97|43.6|287/294|DUF475| OP:NHOMO 127 OP:NHOMOORG 116 OP:PATTERN --------------------------------------------111--------------------- ----1----------1111-1-111-111111----1121-1111----------------------132-------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------122-----------------------------------------------------------------------------------------------------111111------------11111111111------------1111111111111-------21111-------------------------------------------------11--1--------1-----------------12----------------1--------1--1--------------1-------------------------------1--11---------------111-------------------------------------1-----------------------------------------------------------------------------------------------------------------------------1111112131-------------------111111111-----------------111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 340-341| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHcccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccEEEccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //