[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31140.1
DDBJ      :             isochorismatase hydrolase family protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  236/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->190 1j2rC PDBj 1e-21 36.7 %
:RPS:PDB   4->190 3eefA PDBj 2e-24 22.9 %
:RPS:SCOP  2->190 1nf8A  c.33.1.3 * 7e-32 19.3 %
:HMM:SCOP  1->191 1nbaA_ c.33.1.3 * 1.3e-46 30.1 %
:RPS:PFM   33->177 PF00857 * Isochorismatase 1e-16 35.5 %
:HMM:PFM   5->187 PF00857 * Isochorismatase 3.9e-41 25.1 171/174  
:BLT:SWISS 2->190 YECD_ECOLI 4e-21 36.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31140.1 GT:GENE ACD31140.1 GT:PRODUCT isochorismatase hydrolase family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1374316..1374888) GB:FROM 1374316 GB:TO 1374888 GB:DIRECTION - GB:PRODUCT isochorismatase hydrolase family protein GB:PROTEIN_ID ACD31140.1 GB:DB_XREF GI:187712843 LENGTH 190 SQ:AASEQ MKNTFVIVADFINEIVDEKGAFGAHNAQRIKDDETMQKANKLIAWARDNSIQIAHVKVGFTKEYKECSKVSPMFKKAPEYGVLQLGTWATEFHPQMDVQEHDIIITKHRVSALYGTDLELILRANSIEHVIICGVSTSYVVESTVRELHDRDFKVTVIADACNAASQQAHEASLTNLSRIADIVDIDDFI GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 2->190|YECD_ECOLI|4e-21|36.7|177/188| BL:PDB:NREP 1 BL:PDB:REP 2->190|1j2rC|1e-21|36.7|177/187| RP:PDB:NREP 1 RP:PDB:REP 4->190|3eefA|2e-24|22.9|166/168| RP:PFM:NREP 1 RP:PFM:REP 33->177|PF00857|1e-16|35.5|138/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 5->187|PF00857|3.9e-41|25.1|171/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 2->190|1nf8A|7e-32|19.3|176/207|c.33.1.3| HM:SCP:REP 1->191|1nbaA_|1.3e-46|30.1|186/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 396 OP:NHOMOORG 277 OP:PATTERN ---1--12-------2-1-----1---1--11-----------11------1-1-------1-1---- 1---2---------1---------11-----------14----------11---1---------2-111-------------3----------------------1--------------------------------------11--------------1-------------------------111--1-1-----111-1--11------1-11--------------2-222222222222221---1---1--11----------------1----------------------------------------------1111---------11-11----------------1----11--------------------21344----1-2-------------33231-3--2--122-2--121311--1-11-------111111111-11----1-------------------------------11-2321112223211111122332212-2223-111--221-----1---53------11------------1---1--------11----------------2-11--------------------------1--1---------------------------------------121-1112111211112-1221212222112222221322----1111111111111111131-----2--2--------------------------------------------------1-----1--2---31----1111111111111---1----------------------------------------------------------------------------1-1-1--- -----2--------11-1--11111---------------------22-1--1-----1-------------------------------1-----------------3------------------------------------------------------1------------11-----1-1---1-132----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 99.5 SQ:SECSTR #ccEEEEEEccHHHHTcTccccTccHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEcccTTcTTHHHHccccTcccccccccTTcGGGcccGGGcccTTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHTTcEEEEEEEEEEccccTTHHHHHHHHHHccEEEcTTccc DISOP:02AL 190-191| PSIPRED cccEEEEEEcccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHccccccEEEEcccccccccccHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHccEEEHHHcc //