[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31142.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->85 PF11685 * DUF3281 4e-19 61.7 %
:HMM:PFM   2->86 PF11685 * DUF3281 5.6e-26 48.8 84/268  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31142.1 GT:GENE ACD31142.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1378825..1379091) GB:FROM 1378825 GB:TO 1379091 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31142.1 GB:DB_XREF GI:187712845 LENGTH 88 SQ:AASEQ MIENSYTFQKGLPSGATITTLVASLNANAAKAHGTFAADGSSSFNITCDKGYTWLKDVDPAYGTEINKGSGRDSALATWDTKTNKQYR GT:EXON 1|1-88:0| RP:PFM:NREP 1 RP:PFM:REP 2->85|PF11685|4e-19|61.7|81/235|DUF3281| HM:PFM:NREP 1 HM:PFM:REP 2->86|PF11685|5.6e-26|48.8|84/268|DUF3281| OP:NHOMO 14 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22212212---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-89| PSIPRED cccccHHHHccccccccHHHHHHHccccHHHHccccccccccEEEEEEcccccHHHccccccccEEcccccccHHHHHHHHHHHHccc //