[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31144.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y1291_FRATM  RecName: Full=UPF0078 membrane protein FTM_1291;

Homologs  Archaea  0/68 : Bacteria  558/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->185 PF02660 * DUF205 2e-23 38.1 %
:HMM:PFM   10->186 PF02660 * DUF205 4.5e-58 42.4 177/178  
:BLT:SWISS 1->204 Y1291_FRATM 8e-99 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31144.1 GT:GENE ACD31144.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1380224..1380838 GB:FROM 1380224 GB:TO 1380838 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31144.1 GB:DB_XREF GI:187712847 LENGTH 204 SQ:AASEQ MNFLNFSILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTTNVLRIGGKVPAAITLIFDILKGLVPVVIAKVLTGNEFITACTALYAILGHIFPIFFGFKGGKGIATLVGTLFGFSWILGLIFVITWLCVAIITRYSSLSALVATFIASFSVIFTSDLQVAAPFLIIAIIILVKHKGNIQRLISGQESKIGDKAKAKNDSN GT:EXON 1|1-204:0| SW:ID Y1291_FRATM SW:DE RecName: Full=UPF0078 membrane protein FTM_1291; SW:GN OrderedLocusNames=FTM_1291; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->204|Y1291_FRATM|8e-99|100.0|204/204| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 5 TM:REGION 6->28| TM:REGION 53->75| TM:REGION 81->103| TM:REGION 112->134| TM:REGION 151->173| SEG 95->108|ifpiffgfkggkgi| SEG 169->174|iiaiii| RP:PFM:NREP 1 RP:PFM:REP 10->185|PF02660|2e-23|38.1|176/178|DUF205| HM:PFM:NREP 1 HM:PFM:REP 10->186|PF02660|4.5e-58|42.4|177/178|DUF205| GO:PFM:NREP 1 GO:PFM GO:0005886|"GO:plasma membrane"|PF02660|IPR003811| OP:NHOMO 583 OP:NHOMOORG 560 OP:PATTERN -------------------------------------------------------------------- 111----------------------------------------------------------------------------1-1111111-----------------11--1-------------------1--1-2-------------1-111--111-111-11-111111111111-11111111111-11-33333123122211211111122211111-111111-1111111111111111111111111111111111111--11---1---111----1--111111111111111111111111111---1111111-1-----------1------1---1-11----11--111-1111111-1-111111111--1-11111111-----------1---------11-11111--1111-1--1--11111111-111111111-----11-111111111----------------111111---111111111111111111111111111111111111111111111111--1111111111111111111111-----1111111111111111111--1------11111111111-1111111---1-11--111-111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1111111111111--111111111111111------------111111-1------1-1111111111111111111111111--------------111111----------------------1--1--------1-----1111111121--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 204-205| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc //