[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31160.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  116/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:RPS:PFM   6->119 PF09996 * DUF2237 1e-40 62.3 %
:HMM:PFM   4->118 PF09996 * DUF2237 3.3e-58 60.9 115/117  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31160.1 GT:GENE ACD31160.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1406366..1406743) GB:FROM 1406366 GB:TO 1406743 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31160.1 GB:DB_XREF GI:187712863 LENGTH 125 SQ:AASEQ MSEQKNVLGTALKSCCLKPKTGFYRDGFCRTDNHDYGRHVVCAIMTQEFLEYTASRGNDLSTPNPFFDFPGLKPGDKWCLCALRWLEAYQNGVAPEVVLESTHQSALDVIKKEYLFEKAYSNVNA GT:EXON 1|1-125:0| RP:PFM:NREP 1 RP:PFM:REP 6->119|PF09996|1e-40|62.3|114/117|DUF2237| HM:PFM:NREP 1 HM:PFM:REP 4->118|PF09996|3.3e-58|60.9|115/117|DUF2237| OP:NHOMO 148 OP:NHOMOORG 139 OP:PATTERN ------------------------1--111-1------------------------------------ ---------------1111-11--1111111111111----11-------------------1-----------------------------------------1---1----------------------------11-------111-11---11121112111-111-111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----11---1------------------------------------------------11111111-1---------------------------------------------1--------------------------------------11---11----11---1111111-------------11-----1--------------------------------------------------------1--1---2-----------------------11---------------------------------------------------------------------------------------------------------------------------111-111111-------------------111111111---------------------------------11----------------------------------------------------- ---------------221----------------------------11--------------------------------------------2------1--1-----4------------------------------------------------------------------1111----1-----1--11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccccHHHccccccccccccccccccccccccEEEEEEEcHHHHHHHHHHcccccccccccccccccccccEEEEHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHccc //