[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31164.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:342 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->112 PF02624 * YcaO 0.00025 19.6 56/332  
:HMM:PFM   130->168 PF10732 * DUF2524 0.00025 30.8 39/84  
:BLT:SWISS 130->253 PGL2_CAEEL 7e-05 26.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31164.1 GT:GENE ACD31164.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1412649..1413677 GB:FROM 1412649 GB:TO 1413677 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31164.1 GB:DB_XREF GI:187712867 LENGTH 342 SQ:AASEQ MRHLYFNLVSTIMLVLATSSCSTGIPENSKNIKNQVVINQQSQKDTPNDTVPVWFSSGQPNTDQLLYGFGAAKSLEKATQKALADMVQKLQVTVSTTTNFTNVTTNDKVSQKLTQQITTTTTQITIPNYKVINQSELNQIFYVEVQTNKEQTINDLKELMNSNINQAQQLLTTTNNKSSLYRFAIAQQVTKNIQLTNSSLRTLIILVPDSNINSQIEILNQIDNELLNLKRGLQIYIDKQNSGFFYNSLEKFLQVNNYNITDKKDLANINITLKLKDYDNKFNSNEYCIETKIELQTLDDSSNQLSPKQYTIKVCSKQGRLAAIDKAVEIFYSQLNDAESIY GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 130->253|PGL2_CAEEL|7e-05|26.7|120/532| SEG 92->106|vtvstttnftnvttn| SEG 114->126|tqqitttttqiti| HM:PFM:NREP 2 HM:PFM:REP 56->112|PF02624|0.00025|19.6|56/332|YcaO| HM:PFM:REP 130->168|PF10732|0.00025|30.8|39/84|DUF2524| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-11---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 342-343| PSIPRED ccEEEHHHHHHHHHHHHcccccccccccccccccEEEEEcccccccccccccEEEccccccccEEEEEccccHHHHHHHHHHHHHHHHEEEEEEEEEEEEEEEEcccccccccccEEEEEcccEEEccEEEEcHHHcccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccccccccccccccEEEEEEEccccccccccEEEEEEEEEEEEccccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccccc //