[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31190.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:HMM:PFM   6->149 PF05478 * Prominin 6.3e-06 21.3 141/809  
:BLT:SWISS 40->159 TPM2_SCHMA 6e-05 23.1 %
:COIL
:REPEAT 2|41->76|81->116
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31190.1 GT:GENE ACD31190.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1445675..1446184) GB:FROM 1445675 GB:TO 1446184 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31190.1 GB:DB_XREF GI:187712893 LENGTH 169 SQ:AASEQ MKKVALTLITTIGLSVSPVFANEVLTNTTTQTDSYQTGKRLGQKVAQVQTNIKTTAAEVSKKLDKTSKDVEKDVSQAADTLVNKSENAKKILDTKANQASQSLGQMADDAEKDTSQAATTIANKAKAAQSKLVQQTDKSKQALEKTVTNNQDKVQNFKQGFDDGSDNTF GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 40->159|TPM2_SCHMA|6e-05|23.1|117/284| COIL:NAA 36 COIL:NSEG 1 COIL:REGION 117->152| NREPEAT 1 REPEAT 2|41->76|81->116| SEG 26->37|tntttqtdsyqt| SEG 117->128|aattiankakaa| HM:PFM:NREP 1 HM:PFM:REP 6->149|PF05478|6.3e-06|21.3|141/809|Prominin| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccc //