[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31200.1
DDBJ      :             dGTP triphosphohydrolase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  579/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.211.1
:441 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   25->240 2dqbD PDBj 1e-32 47.2 %
:RPS:PDB   25->427 3bg2A PDBj 3e-34 26.3 %
:RPS:SCOP  24->143,301->428 2hekA1  a.211.1.1 * 2e-21 26.1 %
:HMM:SCOP  11->436 2hekA1 a.211.1.1 * 4.3e-62 35.0 %
:RPS:PFM   62->129 PF01966 * HD 2e-15 64.1 %
:HMM:PFM   61->145 PF01966 * HD 2e-17 38.4 73/118  
:BLT:SWISS 27->439 DGT1B_RHILO 2e-88 45.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31200.1 GT:GENE ACD31200.1 GT:PRODUCT dGTP triphosphohydrolase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1465524..1466849 GB:FROM 1465524 GB:TO 1466849 GB:DIRECTION + GB:PRODUCT dGTP triphosphohydrolase GB:PROTEIN_ID ACD31200.1 GB:DB_XREF GI:187712903 LENGTH 441 SQ:AASEQ MVINLYNENDYLRQNNDISKKDNFSPFRRDYARVVHSSSFRRLQAKTQIFPSFENDFFRNRLTHSLEVAQIAKSIAVKLNAEHELNLDYDLIETAALCHDIGHPPFGHNGEVALNKKMREFGGFESNAQTLRLISHTAKKDIDQKQSFGLNLTYRTLAATIKYDCLIPAISDLGYLTKGYYSEEARLVADIKHKLLQPYGVTNIDGKFKTIECYIMDVADDIAYSTYDVEDALKGGFIDPLSMASIDDRLLDKVFKAMPSDLEITKGEIRNILKNIFSDYIDFSADSRDIYKLSKNIANNSLLRTKLTSKLVNSCIQNIELELNQDIPILSKVYLNTTIRKQVEVLKKYILFKIIKSPKLNVLRYRGREIISEIFDILISSTPDESLLPDDIGAIFYNTVSLQAKARIISDNISSMTDRYIIELYNQFKSDPSAMIFKPFS GT:EXON 1|1-441:0| BL:SWS:NREP 1 BL:SWS:REP 27->439|DGT1B_RHILO|2e-88|45.0|411/476| BL:PDB:NREP 1 BL:PDB:REP 25->240|2dqbD|1e-32|47.2|161/357| RP:PDB:NREP 1 RP:PDB:REP 25->427|3bg2A|3e-34|26.3|334/397| RP:PFM:NREP 1 RP:PFM:REP 62->129|PF01966|2e-15|64.1|64/117|HD| HM:PFM:NREP 1 HM:PFM:REP 61->145|PF01966|2e-17|38.4|73/118|HD| RP:SCP:NREP 1 RP:SCP:REP 24->143,301->428|2hekA1|2e-21|26.1|235/369|a.211.1.1| HM:SCP:REP 11->436|2hekA1|4.3e-62|35.0|346/0|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 639 OP:NHOMOORG 582 OP:PATTERN -----------------------------1-------------1--1--------------------- 1211111111111111111-1111111111111111111111111111111111111111111122211-11---11122211-11111111-111---111111-11-1--------------1-----------1111121111------------------1------------------11211111----------------------------------111111-1--------------------1----------------------------------1-------------------------21---111-111-111111111111-111111112-1-112121111111111111----11111111111-11111111111111111111111-1111213112111111111111111111111131111211111111111111--1---1111111--11111111111111111111112111111111112111111111111111211211--1111111111111-111121111-------111111-2221---1-1----11211121112111-111-------------------22-11111111--122211211111111111121211--1-111------11121111111111111-1111211111111111111111111121111111121111111111-121-1-111111111111--1------1121-1112111111-1-11111111111111111122221111111112111111112111111122122111111-------1--------11111111-----------------------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 425 STR:RPRED 96.4 SQ:SECSTR ##TTcTcccGGGcccccccccccccHHHHHHHHHHHcHHHHHGGGcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcTHHHHHHHHHHHHTTTTccTTHHHHHHHHHHHHHTcGGccHHHHHHHHHHcccTTcTTccccGTTcccHHHHHHHccccccccccTcGGGHHHcccGGGHHHHHHHHHHHHccTcccccccccccTTHHHHHHHHHHHHHHHHHHHHHHHcccccGGGGGcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHTcccccTGGGcTTHHHHHHHHHHHHHHHHHHHHHHcccccccHHccHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHH#HHHHHTTTcHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHT############# PSIPRED cEEEEEcHHHHHHHHccccccccccHHHccHHHHcccHHHHHHccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHccccHHHccHHHHHHcccccHHHHHHHHHHHccccccHHccccc //