[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31202.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.80.1
:114 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   2->79 3e6qA PDBj 5e-06 18.9 %
:RPS:SCOP  2->109 1otgA  d.80.1.2 * 2e-04 22.2 %
:HMM:SCOP  2->116 1otgA_ d.80.1.2 * 1.4e-22 36.5 %
:HMM:PFM   23->112 PF02962 * CHMI 1.8e-05 23.3 90/124  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31202.1 GT:GENE ACD31202.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1468114..1468458) GB:FROM 1468114 GB:TO 1468458 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31202.1 GB:DB_XREF GI:187712905 LENGTH 114 SQ:AASEQ MPHIILEISQQFDIAIAKKVIDYSQEFLVDSLPTRLETFKSRVYCYDFSSVGGDDKLDLIHMQIKVLAGREQQHLNNLALELKNQLIDLLNAYIDMLRYRLTLEIIELSPAYAN GT:EXON 1|1-114:0| RP:PDB:NREP 1 RP:PDB:REP 2->79|3e6qA|5e-06|18.9|74/124| HM:PFM:NREP 1 HM:PFM:REP 23->112|PF02962|1.8e-05|23.3|90/124|CHMI| RP:SCP:NREP 1 RP:SCP:REP 2->109|1otgA|2e-04|22.2|108/125|d.80.1.2| HM:SCP:REP 2->116|1otgA_|1.4e-22|36.5|115/125|d.80.1.2|1/1|Tautomerase/MIF| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 97.4 SQ:SECSTR EcEEEEEEEEcccHHHHHHHHHHHHHHHHHTTcccGGGcEEEEEEEccccccccccccEEEEEEEEETTccHHHHHHHHHHHHHHHHHHHcccGGcccHGEEEEEEEccGG### PSIPRED ccEEEEEEHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHEEEEEcccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEcccccc //