[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31213.1
DDBJ      :             ROK family protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  417/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:315 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   83->263 3eo3B PDBj 1e-14 36.2 %
:RPS:PDB   2->117 3d7eO PDBj 3e-06 7.4 %
:RPS:PDB   149->313 3bp8B PDBj 1e-23 21.0 %
:RPS:SCOP  2->118 2hoeA3  c.55.1.10 * 6e-11 19.7 %
:RPS:SCOP  149->313 1z05A2  c.55.1.10 * 3e-18 25.3 %
:HMM:SCOP  1->314 1sz2A1 c.55.1.7 * 2.7e-49 33.2 %
:RPS:PFM   4->189 PF00480 * ROK 9e-12 24.3 %
:HMM:PFM   4->186 PF00480 * ROK 2.5e-36 33.5 176/179  
:BLT:SWISS 3->313 XYLR_ANATD 2e-24 29.0 %
:PROS 134->161|PS01125|ROK
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31213.1 GT:GENE ACD31213.1 GT:PRODUCT ROK family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1481277..1482224) GB:FROM 1481277 GB:TO 1482224 GB:DIRECTION - GB:PRODUCT ROK family protein GB:PROTEIN_ID ACD31213.1 GB:DB_XREF GI:187712916 LENGTH 315 SQ:AASEQ MFIGVDIGGSNMAAGLFDESKNLVTTAKVKSKAKETTEVVVGQLFKVIDKLIAEIPTGKKLVGIGIGVAGLIDKKTSIVRRSVNINISGVNLKQIIQDKYAVKSEIDNDVNVGILGEAKYGAGIGCDDIIGAFVGTGIGGGLVLNGKLYTGNGGLAAELGHTIIKQGGAYCPGCGSQGCLEAYAGKVGIERKIENLAKKNIHSTLIDLVMENGGKLKSSHIKKALDDQDEIAMDILSEAMEYLGTGLGSALNMINPSMVILGGGVMEAIGERYLAQIKRAAMKNSFADIYAECDFKLAKLGDQAGIYGAMELVAG GT:EXON 1|1-315:0| BL:SWS:NREP 1 BL:SWS:REP 3->313|XYLR_ANATD|2e-24|29.0|307/399| PROS 134->161|PS01125|ROK|PDOC00866| SEG 58->71|gkklvgigigvagl| SEG 121->148|gagigcddiigafvgtgiggglvlngkl| BL:PDB:NREP 1 BL:PDB:REP 83->263|3eo3B|1e-14|36.2|174/283| RP:PDB:NREP 2 RP:PDB:REP 2->117|3d7eO|3e-06|7.4|108/495| RP:PDB:REP 149->313|3bp8B|1e-23|21.0|157/380| RP:PFM:NREP 1 RP:PFM:REP 4->189|PF00480|9e-12|24.3|181/181|ROK| HM:PFM:NREP 1 HM:PFM:REP 4->186|PF00480|2.5e-36|33.5|176/179|ROK| RP:SCP:NREP 2 RP:SCP:REP 2->118|2hoeA3|6e-11|19.7|117/128|c.55.1.10| RP:SCP:REP 149->313|1z05A2|3e-18|25.3|158/197|c.55.1.10| HM:SCP:REP 1->314|1sz2A1|2.7e-49|33.2|289/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 621 OP:NHOMOORG 465 OP:PATTERN --1----------------------------------------------------------111--11 -21-3111111111----------------------11441-1112---11-2221-211--21-213333----1111--1111111224113-----11----11212--------------1----2-11-21---3211121-1--111-------------1111-------------2-1--33-212111111321111111353322111222-32123332246111111111111111111111-111111---1111111111111111111111111111111111111111111111111111111211221-12111111121113111111212--11-------1141116552121113--------------------------------1----------1--211-1112221-----11---1---11--------------------------------------------------------------------------------------------------11----1--------------------------------111121-1-11112--1----------------------------------------------111---------------------111-1111111111111-11111111111111111111111111-111111111111111111111111--111111111111-----------------------1-1111111------------------------------2--21211--12211111111222-----------------1111111---------------1--------------------1331113111--- --------------------------------------------------------------------------------------------------------------3111121-11--1-32-114B1-115--111-111-11111-1111111-----------------------------------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 315 STR:RPRED 100.0 SQ:SECSTR EEEEEEEcccEEEEEEEcTTccEEEEEEEEccccccHHHHHHHHHHHHTTTGGGccTccEEEEEEEEccEEETTEEEcccGGGGGGGTTccHHHHHHHHHcccEEEEEHHHHHHHHHHHcTccTTcccEEEEEEcccEEEEEEETTEEcccTTcccccGGGccccTTccccTTTcccccHHHHccHHHHHHHHHHHHccccccTTHHHHcGccccccHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGETTTcHHHHHHHHHHcccHHHHTTccEEEccccccccTHHHHHHHHc DISOP:02AL 315-316| PSIPRED cEEEEEEcccEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccEEEcccEEEEEccccccccccHHHHHHHHHcccEEEEEHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEccEEEccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHHcc //