[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31214.1
DDBJ      :             ROK family protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  218/915 : Eukaryota  37/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:321 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   83->263 3eo3C PDBj 5e-13 28.1 %
:RPS:PDB   1->314 2ap1A PDBj 1e-21 16.1 %
:RPS:SCOP  2->121 2hoeA3  c.55.1.10 * 6e-14 21.0 %
:RPS:SCOP  174->318 2gupA2  c.55.1.10 * 2e-15 11.6 %
:HMM:SCOP  1->321 1sz2A1 c.55.1.7 * 1.6e-53 30.8 %
:RPS:PFM   4->189 PF00480 * ROK 2e-13 24.3 %
:HMM:PFM   4->187 PF00480 * ROK 1.1e-37 31.1 177/179  
:HMM:PFM   227->300 PF08919 * F_actin_bind 3.6e-05 28.4 74/179  
:BLT:SWISS 2->308 GLK_BACHD 4e-21 33.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31214.1 GT:GENE ACD31214.1 GT:PRODUCT ROK family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1482224..1483189) GB:FROM 1482224 GB:TO 1483189 GB:DIRECTION - GB:PRODUCT ROK family protein GB:PROTEIN_ID ACD31214.1 GB:DB_XREF GI:187712917 LENGTH 321 SQ:AASEQ MYIGLDIGGSNISAGIFDEQKNLIKTAKVKSKGKSDADVILAQIFKVINKLLDSSNKNKIKAIGIGIAGFVDSKSGVLNFSANINLNGINIAQEVSQKFANVPVFIENDVNVGVIGEWKYGAGRSHQNIVGIFAGTGIGGGLVVNNQFLYGVTGGAGAVGHVTINSQGAYCQSCGSQGCLETYAGKVGIENRLMNLHKKGIKSILIDFVLENKGKLKGSHLKKALAAKDKIAEDIMTNAMSNLGIAVANYINLLNPSMVLFGGGIIEAVGQQYLDTIYQSYSKYAFKTMLDACELKIATLGDNSGVYGAMDIAVNRLEGNW GT:EXON 1|1-321:0| BL:SWS:NREP 1 BL:SWS:REP 2->308|GLK_BACHD|4e-21|33.2|301/330| SEG 56->69|nknkikaigigiag| SEG 129->144|ivgifagtgiggglvv| SEG 151->163|gvtggagavghvt| SEG 221->235|lkkalaakdkiaedi| BL:PDB:NREP 1 BL:PDB:REP 83->263|3eo3C|5e-13|28.1|178/286| RP:PDB:NREP 1 RP:PDB:REP 1->314|2ap1A|1e-21|16.1|292/305| RP:PFM:NREP 1 RP:PFM:REP 4->189|PF00480|2e-13|24.3|181/181|ROK| HM:PFM:NREP 2 HM:PFM:REP 4->187|PF00480|1.1e-37|31.1|177/179|ROK| HM:PFM:REP 227->300|PF08919|3.6e-05|28.4|74/179|F_actin_bind| RP:SCP:NREP 2 RP:SCP:REP 2->121|2hoeA3|6e-14|21.0|119/128|c.55.1.10| RP:SCP:REP 174->318|2gupA2|2e-15|11.6|129/175|c.55.1.10| HM:SCP:REP 1->321|1sz2A1|1.6e-53|30.8|299/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 316 OP:NHOMOORG 257 OP:PATTERN -------------------------------------------------------------1-1---- -21-1111111--------------------------------1-------------------1---1221-------------11-11121-2-1---1-----11112--------------1------1--1----11111--------------------------------------------33---11111111111111111222-211121--32-1111114111111111111111111111--1----1---11111111--1111211111111111111111111111111111111111-1111211121--111111111111-11-111-11--1--------1-1-12544-111-1-----------------------------------------------2------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------2--21211---11--------111--------------------1111------------------------------------1121112111--1 --------------------------------------------------------------------------------------------------------------3111121-11--1-32-11381-114--111-111--11-1-1111111------------------------------------1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 321 STR:RPRED 100.0 SQ:SECSTR EEEEEEEcccEEEEEEEETTccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccTcccEEEEEEccccccTTcccccTTcTTTTTccHHHHHHHHHETccEEEEEHHHHHHHHHHTcTTGGGccEEEEEEEcccEEEEEEETTEEEccTTccTTcGGGccccHHHHHHcTTcccccTHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHTTcHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGcGHTHHHHccGGGcGGGccHTTccccEEEEcccTTTHHHHHHHHTTcHHHccTc PSIPRED cEEEEEEcccEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEccccEEEEccccccccccHHHHHHHHHccccEEEEcHHHHHHHHHHHcccccccccEEEEEEcccccEEEEEccEEEcccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHcccc //