[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31216.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:190 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   44->70 PF02825 * WWE 0.00087 11.1 27/72  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31216.1 GT:GENE ACD31216.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1484637..1485209) GB:FROM 1484637 GB:TO 1485209 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31216.1 GB:DB_XREF GI:187712919 LENGTH 190 SQ:AASEQ MKTKFIIASLFLSAGVCSISYADTVDSTSICPTDLKYKTIGMRDMSFRYAQYKDHICAILEVDLNKNKQWREKGSGWFAAGFGAKTMKGSNMFIFVPNKSQSQDIHYDIFANIGGAYGPTKPLDTKPQKGQIELLSSSLAKVEFALYPQKIPGLATNGNIDMIFSHSKAGVYQFAPGHVAAYDDKSINLK GT:EXON 1|1-190:0| HM:PFM:NREP 1 HM:PFM:REP 44->70|PF02825|0.00087|11.1|27/72|WWE| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 190-191| PSIPRED cccEEEEEEHHHcccEEEEEEccccccccccccccEEEEEcccccEEEHHHHcccEEEEEEEEccccHHHHHccccEEEcccccccccccEEEEEEccccccccEEEEEEEcccccccccccccccccccEEEEEEcccEEEEEEEcccccccccccccEEEEEEcccccEEEEccccEEEccccccccc //