[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31220.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:ERPA_FRATW   RecName: Full=Iron-sulfur cluster insertion protein erpA;

Homologs  Archaea  11/68 : Bacteria  624/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->116 2apnA PDBj 2e-37 59.8 %
:RPS:PDB   10->116 2apnA PDBj 4e-35 59.8 %
:RPS:SCOP  1->102 1nwbA  b.124.1.1 * 4e-28 38.6 %
:HMM:SCOP  10->102 1nwbA_ b.124.1.1 * 7.7e-29 45.2 %
:RPS:PFM   11->102 PF01521 * Fe-S_biosyn 2e-19 45.7 %
:HMM:PFM   11->102 PF01521 * Fe-S_biosyn 4.4e-30 44.0 91/91  
:BLT:SWISS 1->116 ERPA_FRATW 5e-64 100.0 %
:PROS 97->114|PS01152|HESB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31220.1 GT:GENE ACD31220.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1487219..1487569) GB:FROM 1487219 GB:TO 1487569 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31220.1 GB:DB_XREF GI:187712923 LENGTH 116 SQ:AASEQ MSEVVQSVDPINFTEAASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYAFAFDNEVKEDDMVITKNGVRLLVDSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV GT:EXON 1|1-116:0| SW:ID ERPA_FRATW SW:DE RecName: Full=Iron-sulfur cluster insertion protein erpA; SW:GN Name=erpA; OrderedLocusNames=FTW_1543; SW:KW Complete proteome; Iron; Iron-sulfur; Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->116|ERPA_FRATW|5e-64|100.0|116/116| GO:SWS:NREP 2 GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 97->114|PS01152|HESB|PDOC00887| BL:PDB:NREP 1 BL:PDB:REP 10->116|2apnA|2e-37|59.8|107/114| RP:PDB:NREP 1 RP:PDB:REP 10->116|2apnA|4e-35|59.8|107/114| RP:PFM:NREP 1 RP:PFM:REP 11->102|PF01521|2e-19|45.7|92/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 11->102|PF01521|4.4e-30|44.0|91/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 1->102|1nwbA|4e-28|38.6|101/101|b.124.1.1| HM:SCP:REP 10->102|1nwbA_|7.7e-29|45.2|93/101|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 1559 OP:NHOMOORG 816 OP:PATTERN ------------------------1--11-11-----------------1111-------------11 1211111111111111111-111111111111111111111122111111111111111111111111111-----------112111-----------1-111111112--------------1---------2-11111---112333332111111111-2212433311111111111111111---1111111111111111111111111111111111------211111111111111-111111--------------------------------------------------------------------------------------------------1---------------------1-1222222222332332223333322222222222-2232232223221222333222223322222233332222222222212212223-1111111112222222222222221111222223222222222222222222232222222442222222224222224232222322222222222222222331-----------------------222222---------------------------332221222122222222222222222212222--222211111123222323333333333-333333333333322332333333333333333333333333333323333223333333333332212222222222422222222222222222222222222222322222222222222222211111111122222222222222222222222222222223-----------------------------------------------------42- 21--221-4---2222122-211211122221-12111112-121211222222-2112211222111-2212221111112222122--2212111121211333-2223322321-22222232121362-2242211212222221121-2133232122211-224513222332S2223375561433332222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 95.7 SQ:SECSTR #####ccccccEEccHHHHHHHHHHHHHTccccEEEEcccccccccccccEEEccccccccEEEEccccEEEEcHHHHHHHTTcEEEEEccccccEEEEEcHHHHccccccccccc DISOP:02AL 116-117| PSIPRED ccccccccccEEEcHHHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEEEccccccccEEEEEccEEEEEcHHHHHHHcccEEEEEEcccccEEEEEcccccccccccccccc //