[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31224.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->103 PF04999 * FtsL 1.5e-16 26.9 78/97  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31224.1 GT:GENE ACD31224.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1491772..1492122) GB:FROM 1491772 GB:TO 1492122 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31224.1 GB:DB_XREF GI:187712927 LENGTH 116 SQ:AASEQ MMLTNRQIRVRLFESLKNSFFKKTVGISFALLFILLITAFSLIVVRFEYKLQLNEQKNLILEDTRLDEQWSQIVLEYSSLATPTAVEKFAQKEKMTLPTRKTIGFLNEQKEELNNE GT:EXON 1|1-116:0| TM:NTM 1 TM:REGION 24->46| SEG 27->43|isfallfillitafsli| HM:PFM:NREP 1 HM:PFM:REP 26->103|PF04999|1.5e-16|26.9|78/97|FtsL| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 14-34,116-117| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHccc //