[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31228.1
DDBJ      :             glutamine amidotransferase, SNO family
Swiss-Prot:PDXT_FRATW   RecName: Full=Glutamine amidotransferase subunit pdxT;         EC=2.6.-.-;AltName: Full=Glutamine amidotransferase glutaminase subunit pdxT;

Homologs  Archaea  65/68 : Bacteria  223/915 : Eukaryota  115/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:179 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->179 2issE PDBj 1e-39 44.3 %
:RPS:PDB   4->179 2abwA PDBj 1e-15 27.3 %
:RPS:SCOP  4->177 1q7rA  c.23.16.1 * 3e-21 43.1 %
:HMM:SCOP  4->179 2abwA1 c.23.16.1 * 1.3e-37 38.1 %
:RPS:PFM   7->179 PF01174 * SNO 6e-42 49.1 %
:HMM:PFM   7->178 PF01174 * SNO 2e-51 42.4 172/188  
:BLT:SWISS 1->179 PDXT_FRATW e-101 100.0 %
:PROS 42->52|PS01236|PDXT_SNO_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31228.1 GT:GENE ACD31228.1 GT:PRODUCT glutamine amidotransferase, SNO family GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1496888..1497427) GB:FROM 1496888 GB:TO 1497427 GB:DIRECTION - GB:PRODUCT glutamine amidotransferase, SNO family GB:PROTEIN_ID ACD31228.1 GB:DB_XREF GI:187712931 LENGTH 179 SQ:AASEQ MTQKVGVLAIQGGYQKHADMFKSLGVEVKLVKFNNDFDSIDRLVIPGGESTTLLNLLNKHQIFDKLYNFCSSKPVFGTCAGSIILSKGEGYLNLLDLEVQRNAYGRQVDSFVADISFNDKNITGVFIRAPKFIVVGNQVDILSKYQNSPVLLRQANILVSSFHPELTQDPTIHEYFLAM GT:EXON 1|1-179:0| SW:ID PDXT_FRATW SW:DE RecName: Full=Glutamine amidotransferase subunit pdxT; EC=2.6.-.-;AltName: Full=Glutamine amidotransferase glutaminase subunit pdxT; SW:GN Name=pdxT; OrderedLocusNames=FTW_1553; SW:KW Complete proteome; Glutamine amidotransferase; Pyridoxal phosphate;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->179|PDXT_FRATW|e-101|100.0|179/179| GO:SWS:NREP 2 GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 42->52|PS01236|PDXT_SNO_1|PDOC00950| BL:PDB:NREP 1 BL:PDB:REP 4->179|2issE|1e-39|44.3|176/184| RP:PDB:NREP 1 RP:PDB:REP 4->179|2abwA|1e-15|27.3|176/216| RP:PFM:NREP 1 RP:PFM:REP 7->179|PF01174|6e-42|49.1|173/184|SNO| HM:PFM:NREP 1 HM:PFM:REP 7->178|PF01174|2e-51|42.4|172/188|SNO| RP:SCP:NREP 1 RP:SCP:REP 4->177|1q7rA|3e-21|43.1|174/202|c.23.16.1| HM:SCP:REP 4->179|2abwA1|1.3e-37|38.1|176/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 437 OP:NHOMOORG 403 OP:PATTERN 1111111111111111-1111111111111111111111111111111111111111111-1111-11 1111111-11111-11111-11111111111111111111111111-111111111111111111-111111111111-11-1---------1-------------------------------1-----------1111111111-------------------------------------1111111-11111111111111111111111111111111111111111111111111111111111111----------------------1-------------11111111111-----------------------1--11-----1----1-11----------111122111---111111--1------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1-1---------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111---1-----------------------------111111111---------------------------------------------------------------------------11-1111111--- 11--1-1-1----11-1111111111111-1111111111111-1111111111--111111--111111-11114333211111111-1211111--1-111111-13--------------------------------------------------11--11--------1-1111F1111-3121111-111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 100.0 SQ:SECSTR cccEEEEEcTTcccHHHHHTTccTTEEEEEEccHHHHHTccEEEEccccHHHHHTHHHHHHHHHHHHHHHTcccEEEETHHHHHTEEGGcccccEEEEEEcccccEEEEEcEEccccTTccTTcEEEEEcccEEEcTTcEEEEEEEETTEEEEETTEEEEcccGGGccccHHHHHHHHH PSIPRED cccEEEEEEccccHHHHHHHHHHcccEEEEEccHHHHHHccEEEEccccHHHHHHHHHHcccHHHHHHHHccccEEEEEHHHHHHHcccccccEEEEEEEEcccccccccEEEccccccccEEEEEEEEEEEEEcccccEEEEEEccEEEEEEcccEEEEEEcccccccHHHHHHHHcc //