[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31229.1
DDBJ      :             pyridoxine/pyridoxal 5-phosphate biosynthesis protein
Swiss-Prot:PDXS_FRATM   RecName: Full=Pyridoxal biosynthesis lyase pdxS;         EC=4.-.-.-;

Homologs  Archaea  64/68 : Bacteria  239/915 : Eukaryota  129/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:287 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->272 2zbtC PDBj 5e-88 66.7 %
:RPS:PDB   49->255 3cr8C PDBj 2e-26 13.0 %
:RPS:SCOP  15->268 1znnA1  c.1.2.6 * 1e-27 61.2 %
:HMM:SCOP  15->268 1znnA1 c.1.2.6 * 4.4e-61 32.8 %
:RPS:PFM   6->209 PF01680 * SOR_SNZ 5e-76 68.1 %
:RPS:PFM   189->252 PF05690 * ThiG 4e-08 42.6 %
:HMM:PFM   3->209 PF01680 * SOR_SNZ 4.3e-110 74.4 207/209  
:HMM:PFM   204->253 PF05690 * ThiG 1.2e-08 40.0 50/247  
:BLT:SWISS 1->287 PDXS_FRATM e-150 100.0 %
:PROS 202->220|PS01235|PDXS_SNZ_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31229.1 GT:GENE ACD31229.1 GT:PRODUCT pyridoxine/pyridoxal 5-phosphate biosynthesis protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1497430..1498293) GB:FROM 1497430 GB:TO 1498293 GB:DIRECTION - GB:PRODUCT pyridoxine/pyridoxal 5-phosphate biosynthesis protein GB:PROTEIN_ID ACD31229.1 GB:DB_XREF GI:187712932 LENGTH 287 SQ:AASEQ MSDINIKIGLAEMLKGGVIMDVVNAEQAEIAQQAGAVAVMALERVPADIRKDGGIARMSDPKLIKEIMSVVSIPVMAKARIGHFVEAQILESLGVDFIDESEVLTPADELNHIDKDSFKVPFVCGCTNLGEALRRIGEGAALIRTKGEAGTGNIVEAVRQLRQVNKDINYIKNADKSELMAIAKNLQAPYDLVTYVHKNGKLPVPNFSAGGVATPADAALMMQLGAESVFVGSGIFKSADPFKRARAIVSAVTYYNDAKILAEVSEDLGEPMTGINCDFEKFSQRGW GT:EXON 1|1-287:0| SW:ID PDXS_FRATM SW:DE RecName: Full=Pyridoxal biosynthesis lyase pdxS; EC=4.-.-.-; SW:GN Name=pdxS; OrderedLocusNames=FTM_1393; SW:KW Complete proteome; Lyase; Pyridoxal phosphate. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->287|PDXS_FRATM|e-150|100.0|287/287| GO:SWS:NREP 1 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 202->220|PS01235|PDXS_SNZ_1|PDOC00949| SEG 22->39|vvnaeqaeiaqqagavav| BL:PDB:NREP 1 BL:PDB:REP 6->272|2zbtC|5e-88|66.7|267/270| RP:PDB:NREP 1 RP:PDB:REP 49->255|3cr8C|2e-26|13.0|200/493| RP:PFM:NREP 2 RP:PFM:REP 6->209|PF01680|5e-76|68.1|204/208|SOR_SNZ| RP:PFM:REP 189->252|PF05690|4e-08|42.6|61/245|ThiG| HM:PFM:NREP 2 HM:PFM:REP 3->209|PF01680|4.3e-110|74.4|207/209|SOR_SNZ| HM:PFM:REP 204->253|PF05690|1.2e-08|40.0|50/247|ThiG| GO:PFM:NREP 1 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF05690|IPR008867| RP:SCP:NREP 1 RP:SCP:REP 15->268|1znnA1|1e-27|61.2|245/245|c.1.2.6| HM:SCP:REP 15->268|1znnA1|4.4e-61|32.8|253/0|c.1.2.6|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 482 OP:NHOMOORG 432 OP:PATTERN 1111111111111111-111111111111111-111111111111111111111111111-1111-11 1111111111111111111-1111111111111111112111111111111121211111111111111111111111-11-1---------1-------------------------------1-----------1111111111-------------------------------------1111111-11111111111111111111111111111111111111111111111111111111111111----------------------1-------------11111111111-----------------------1--111111-11---1-111------11-1111111311-1111111-11------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1-1---------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111---1-----------------------------111111111-----------------------------------------------1---------------------------11-1111111--- 11--111-1---211111111111111111111111111111111111111111111111111-111111-11116334211111111-12111111111111111-141-------------------------------------------------111-11--------1-1111A111115363131111121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 99.3 SQ:SECSTR ##HcEEEHHHHcccGGGccccEEEEcTTTccEEEEEEEEHHHHTcccccccGGGcccccHHHHHHHHHHHTTccEEEEEEccHHHHHHHHHHHHHEEccHHHHHHHHHHcccTTcccccccccEEEccccGGGTTccTTcEEEcTTccEEEEEEEEEEEETTEEEEEEEHEEEcccccccTTTTTcccHHHHHHHHHHTTcccEEEEcccccccHHHHHHHHHHHHHEEEEcccccccccccHHHHHHHHHGGGcHHHcHHHHHHccccccccccEEEEEccccccc PSIPRED ccHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHcccEEEEEEHHccHHHHHcccccccccHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHccccccHHHccccccHHHccccccEEcccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccccEEEEcHHHHccccHHHHHHHHHHHHHHHccccHHHHHHccccccccccccHHHHHHcccc //