[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31231.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.269.1
:266 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   131->263 2vh4B PDBj 6e-04 35.1 %
:RPS:PDB   68->187 3cryA PDBj 2e-11 12.7 %
:RPS:SCOP  67->187 1vkbA  d.269.1.1 * 1e-09 15.4 %
:HMM:PFM   221->254 PF09779 * DUF2349 0.00038 32.4 34/131  
:HMM:PFM   1->20 PF11337 * DUF3139 0.00052 38.9 18/85  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31231.1 GT:GENE ACD31231.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1501016..1501816 GB:FROM 1501016 GB:TO 1501816 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31231.1 GB:DB_XREF GI:187712934 LENGTH 266 SQ:AASEQ MKKKNILFLILIVVVITASFLLGKKSGFNKAESIHESELRILEQSKLSQTPEDSLNCRPEVNPNKDNYVIGYGSLMNKDSRQITVPNATYAAPILVSGFERLWASRGEKSRATFLLAVPNKGYAMNAIYYKADAKDISATDLREASYCRVKIPRKDIVPLGIKSLPKGDFWMYVKDFKDAEFPNKDYPILQTYADTFMTGCLQTQAEFNLTEFGKLCFDTTYNWDLANWLYDRSNPRYSRYSQDTEKYRPQIDKIIRRLTFDDDPL GT:EXON 1|1-266:0| TM:NTM 1 TM:REGION 5->23| SEG 6->16|ilflilivvvi| BL:PDB:NREP 1 BL:PDB:REP 131->263|2vh4B|6e-04|35.1|97/374| RP:PDB:NREP 1 RP:PDB:REP 68->187|3cryA|2e-11|12.7|118/169| HM:PFM:NREP 2 HM:PFM:REP 221->254|PF09779|0.00038|32.4|34/131|DUF2349| HM:PFM:REP 1->20|PF11337|0.00052|38.9|18/85|DUF3139| RP:SCP:NREP 1 RP:SCP:REP 67->187|1vkbA|1e-09|15.4|117/147|d.269.1.1| OP:NHOMO 32 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------1-2----1--------------------------------------------111111111----1111111-111------------------------------------------------------------------------- --------------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 64.3 SQ:SECSTR ################################################################cEEEEEEccGGGcHHHHHHHcTTcEEEEEEEEEEEEEEEEEETTcccTTEEEEEEEEEEEEEEEEEEEEGGGHHHHHHHTTGGGTccEEEETTEEEEETTccEEEEEEEEcccEEEccccHHH##############HHHHHHHHccEEEEEcccHHHHHHHHHHHHHHTT##############TccccccccccTTE### PSIPRED cccccEEHHHHHHHHHHHHHHHcccccccHHHHccHHHHHHHHHHHccccccccccccccccccccccEEEEEHHcccccccccccccccEEEEEEEEEEEEEEEEccccEEEEEEEEEccccEEEEEEEEccHHHHHHHHHHHHccEEEEccHHHHccccccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccc //