[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31233.1
DDBJ      :             protein-disulfide isomerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->201 3gykB PDBj 1e-09 29.1 %
:RPS:PDB   58->201 3dvxA PDBj 1e-08 17.5 %
:RPS:SCOP  48->201 1z6mA1  c.47.1.13 * 2e-10 21.1 %
:HMM:SCOP  44->220 1z6mA1 c.47.1.13 * 1e-19 28.1 %
:HMM:PFM   71->107 PF01323 * DSBA 0.00016 29.7 37/193  
:HMM:PFM   1->72 PF07273 * DUF1439 8.5e-05 32.9 70/177  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31233.1 GT:GENE ACD31233.1 GT:PRODUCT protein-disulfide isomerase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1502840..1503607) GB:FROM 1502840 GB:TO 1503607 GB:DIRECTION - GB:PRODUCT protein-disulfide isomerase GB:PROTEIN_ID ACD31233.1 GB:DB_XREF GI:187712936 LENGTH 255 SQ:AASEQ MKKLLVTLGISSVLILSSCANHQNIQAQEASVNHKTSNDYAKIIAIPDIVKDLLSDPSTPTVGPQDANKAVVVFFDYGCGKCAEISKEINKLMKENPNVKFIFKAYPSVKRDAKVANYASLVANEAYLQGGSELFLAYNKAIFAQRETNGELTDQDVDNVVKRLGIKVNDTKLKQKAAAEELDTRKLGKLIGFQGPHSFVILPTNLASMNANDLGNNVDKVYVISDKQTNAITDNYQQAAKWVATNIQAQLNNIK GT:EXON 1|1-255:0| BL:PDB:NREP 1 BL:PDB:REP 53->201|3gykB|1e-09|29.1|134/168| RP:PDB:NREP 1 RP:PDB:REP 58->201|3dvxA|1e-08|17.5|137/187| HM:PFM:NREP 2 HM:PFM:REP 71->107|PF01323|0.00016|29.7|37/193|DSBA| HM:PFM:REP 1->72|PF07273|8.5e-05|32.9|70/177|DUF1439| RP:SCP:NREP 1 RP:SCP:REP 48->201|1z6mA1|2e-10|21.1|142/172|c.47.1.13| HM:SCP:REP 44->220|1z6mA1|1e-19|28.1|167/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 55 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------------------1-1-----------111-----11----------------------1-------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------1----------------------111-----1111--111-121111------------------1-------11111-----------------------------------------------------222222222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 64.3 SQ:SECSTR ############################################ccccTTTcEcTTTccccccccTTcEEEEEEEcTTcHHHHHHHHHHHHHHHHccTTEEEEEEEccccGGHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHTTcccTTcHHHHHHHHHHcccccHHHHHHHHcHHHHHHHHHHHHHTcccccEEEETTTEEcc############################################### DISOP:02AL 255-256| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEccccccEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHcccccccEEEEccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccc //