[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31238.1
DDBJ      :             conserved hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:346 amino acids
:PSIPRED
:RPS:PFM   15->302 PF01594 * UPF0118 2e-05 20.1 %
:HMM:PFM   16->333 PF01594 * UPF0118 1.1e-42 20.8 312/327  
:BLT:SWISS 77->338 Y1211_METTH 2e-06 20.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31238.1 GT:GENE ACD31238.1 GT:PRODUCT conserved hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1509667..1510707 GB:FROM 1509667 GB:TO 1510707 GB:DIRECTION + GB:PRODUCT conserved hypothetical membrane protein GB:PROTEIN_ID ACD31238.1 GB:DB_XREF GI:187712941 LENGTH 346 SQ:AASEQ MLLFKMTSYTNIKKLSIICLVGALIGWVLYPFIYPILFAGLLAIILAPLQLYLEQHIGRHKSSFIIVIAILLCIFIPLLIVLSYVITEIISYLQHSESLSQTFSQLSKSIANIPYIGSTLQEHFDNLLNMVNQDKDMIISNLGKILPTIRYIGFTSVSLLTDFLITLLLVYQFLVSSTSLEKFLKKIILKDFHDSDSFISAAIATTRRVSLAIFLTAMLVGTMMTITFSMVGIPSPILFGFIAAIASMVPFMVGIIYILIGASVFVIYGATKAIIILIIGFSLNIFTDNIMQPKIINKQVKLSFVASLIGIMGGIHAFGFIGIFLGPVIFNVAFVGIEKLMNNQEY GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 77->338|Y1211_METTH|2e-06|20.4|245/334| TM:NTM 7 TM:REGION 23->45| TM:REGION 66->88| TM:REGION 153->175| TM:REGION 209->231| TM:REGION 239->261| TM:REGION 268->290| TM:REGION 308->330| SEG 36->53|ilfagllaiilaplqlyl| SEG 64->76|fiiviaillcifi| SEG 159->169|lltdflitlll| SEG 274->279|iiilii| SEG 309->326|igimggihafgfigiflg| RP:PFM:NREP 1 RP:PFM:REP 15->302|PF01594|2e-05|20.1|283/328|UPF0118| HM:PFM:NREP 1 HM:PFM:REP 16->333|PF01594|1.1e-42|20.8|312/327|UPF0118| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEcccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //