[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31240.1
DDBJ      :             proton-dependent oligopeptide transporter (POT) family protein, di- or tripeptide:H+ symporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  373/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:481 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  33->229 1pv6A  f.38.1.2 * 5e-07 15.4 %
:HMM:SCOP  1->296 1pw4A_ f.38.1.1 * 1e-26 21.0 %
:HMM:SCOP  323->478 1pw4A_ f.38.1.1 * 9.5e-13 24.6 %
:RPS:PFM   102->193,269->426 PF00854 * PTR2 2e-18 45.7 %
:HMM:PFM   78->423 PF00854 * PTR2 9.5e-42 23.2 345/373  
:BLT:SWISS 1->478 TPPB_ECOLI 2e-54 28.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31240.1 GT:GENE ACD31240.1 GT:PRODUCT proton-dependent oligopeptide transporter (POT) family protein, di- or tripeptide:H+ symporter GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1512286..1513731 GB:FROM 1512286 GB:TO 1513731 GB:DIRECTION + GB:PRODUCT proton-dependent oligopeptide transporter (POT) family protein, di- or tripeptide:H+ symporter GB:PROTEIN_ID ACD31240.1 GB:DB_XREF GI:187712943 LENGTH 481 SQ:AASEQ MESLKHPKGLKFLFFAEMWERFSYYGLAAILILYMTQRLNFTDANAALIFGSYVTFLYITTAVGGILADRVIGYRRCVLIGGISIISGHIIMALSGSSDTALFLGLGCISAGTGFFKSNVSTMVGRLYDDKEALRNSGFAYFYTGINLGAVIATFVVGYVGEKIGWHYGFSLTAFGMALGLICFESGKKHFPKSCDEPNFEIMKKSLFLGLNVWYAIILFVVVSACVFAHLIAHPTESMVIISLSGIVLLIYLISLWKSLGKAQKTNIAILLILSIFMLFYWSLSSQTSISIPLFIKSNIDLHILGFNMPVTTVMATQLSLLIIINPFFGILWQKLGQYKKEPSDELKFVFSLIFLALCFLFLSIAGSIAAHAGHSNVIWLLLCYLMLVFGELCISPVGLALVTRLAPEHLKSTMMGVWWTISAYAGFFGGVISSNIAVTKNTPASSFASGYFKLFVAAIIMAVILFALTPILKKLTKLRV GT:EXON 1|1-481:0| BL:SWS:NREP 1 BL:SWS:REP 1->478|TPPB_ECOLI|2e-54|28.8|468/500| TM:NTM 13 TM:REGION 22->44| TM:REGION 49->71| TM:REGION 77->97| TM:REGION 99->121| TM:REGION 155->177| TM:REGION 207->229| TM:REGION 238->260| TM:REGION 271->293| TM:REGION 314->336| TM:REGION 347->369| TM:REGION 381->403| TM:REGION 416->438| TM:REGION 452->473| SEG 80->91|iggisiisghii| SEG 241->256|iislsgivlliylisl| RP:PFM:NREP 1 RP:PFM:REP 102->193,269->426|PF00854|2e-18|45.7|248/361|PTR2| HM:PFM:NREP 1 HM:PFM:REP 78->423|PF00854|9.5e-42|23.2|345/373|PTR2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00854|IPR000109| GO:PFM GO:0006857|"GO:oligopeptide transport"|PF00854|IPR000109| GO:PFM GO:0016020|"GO:membrane"|PF00854|IPR000109| RP:SCP:NREP 1 RP:SCP:REP 33->229|1pv6A|5e-07|15.4|195/417|f.38.1.2| HM:SCP:REP 1->296|1pw4A_|1e-26|21.0|291/447|f.38.1.1|1/2|MFS general substrate transporter| HM:SCP:REP 323->478|1pw4A_|9.5e-13|24.6|134/447|f.38.1.1|2/2|MFS general substrate transporter| OP:NHOMO 948 OP:NHOMOORG 437 OP:PATTERN -------------------------------------------------------------------- --1-1-121111---------1---1------1---1111------1----11-11-------1--1112------------------112112112--33222111112--------------------------------------------------------1-----------------------4-11222222232222222--11112231111-11111111--21111111111111121122111-11-21-1111111111---111111----------------------------------111---1---116666666-6--3---111-------------1-------------1-11113----------1---------------------------------------------211-------------------2121-1-----------11---------------1--11211-----1111111111111111111-1111---------------------------21-------------1---------1---1---------222222--------1322-----------------21-1--3111-333333-233332221333--1----------41--4224444444444-444444444444444444455511223444444444444444443332224--311121111222---12323366651--1----------------11111---12-------------------A86738648-1442122221212222111111111111----111111------------------------------------------------1 ----13-------------------------------------------------------------------------------------------------------1231342-11--1-11111-------21---1-15-211-1112A-121244I22131622-2223-11-31112136A9-54--2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 481-482| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccEEccHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //