[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31242.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->101 2qsdG PDBj 2e-21 51.7 %
:RPS:PFM   16->67 PF07566 * DUF1543 3e-08 46.2 %
:HMM:PFM   16->66 PF07566 * DUF1543 5.4e-24 47.1 51/52  
:HMM:PFM   92->137 PF07566 * DUF1543 9.1e-13 34.8 46/52  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31242.1 GT:GENE ACD31242.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1515432..1515935) GB:FROM 1515432 GB:TO 1515935 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31242.1 GB:DB_XREF GI:187712945 LENGTH 167 SQ:AASEQ MSQLFIVYLGGSAPKANIELHDVQFVIADNIEGTYEQLRQNWFGTVKDLHLDSYKAVKGADGYQISIQDKPQNSDKKLYFVNLGGYDASKLNELHEFALFVAADKTEAKEKAKQSLLKNSLHQHKDNLMEVDDCLELSKVDGKYIHLTPSDKEYDLKPYWFGYRVIG GT:EXON 1|1-167:0| SEG 102->113|aadkteakekak| BL:PDB:NREP 1 BL:PDB:REP 2->101|2qsdG|2e-21|51.7|89/145| RP:PFM:NREP 1 RP:PFM:REP 16->67|PF07566|3e-08|46.2|52/54|DUF1543| HM:PFM:NREP 2 HM:PFM:REP 16->66|PF07566|5.4e-24|47.1|51/52|DUF1543| HM:PFM:REP 92->137|PF07566|9.1e-13|34.8|46/52|DUF1543| OP:NHOMO 54 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------1---1-----------------------------------------------111111--------11111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------1------------------------------------------1-----------------------------------------------------------------------------1111111-------------------------------------------------------------------1----1-1-----------------------------------11-------------------------------------1---------------------------1----------------------------------------------11111-1-1--------1-1-1111----11-1-1--1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 55.7 SQ:SECSTR #cEEEEEEEEEEcTTccccEEEEEEEEEcc#GGGHHHHHHHcccEEEEEEEEEEEEEcEETTEEEEEEcccc#cccEEEEEEccccc#####ccccEEEEE################################################################## PSIPRED ccEEEEEEEcccccccccEEEEEEEEEcccHHHHHHHHHHccccccccccEEEEEEEEccccEEEEEEcccccccccEEEEEEccccHHHHHHHHcEEEEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHccEEEEccccEEEEEEEccccccccccccEEEEEc //