[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31249.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:220 amino acids
:PSIPRED
:HMM:PFM   31->171 PF09917 * DUF2147 1.9e-29 34.8 112/114  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31249.1 GT:GENE ACD31249.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1526403..1527065) GB:FROM 1526403 GB:TO 1527065 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31249.1 GB:DB_XREF GI:187712952 LENGTH 220 SQ:AASEQ MLRSLIVIIVAIFVFSFAYTEEDWQGLYATGYWLQRDSVTKTNIAVIHAYDNQNGNLNAEVYVPLSNVDDGIIHEPIIYCEKCGKGDAYGNLYDYSSGKDKYQGLEFVWNAKKTDNGNLAKGKGPLYTDGAVLNPHDGKYYHVKARTVEYGKKIYVRAYWGFLGKSEHWQRISADQAQKIKNLCGLTADNVYTYEDKNGKVNNKELFKECATRNFVKDPL GT:EXON 1|1-220:0| TM:NTM 1 TM:REGION 1->21| SEG 6->18|iviivaifvfsfa| HM:PFM:NREP 1 HM:PFM:REP 31->171|PF09917|1.9e-29|34.8|112/114|DUF2147| OP:NHOMO 17 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------223212212---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccEEEEEEEccccEEEEEEEEEcccccccccccccccccccccccccccccHHHHccccEEEEEEEEcccccccccccccccccccccEEEccccccEEEEEEEEEccccEEEEEEEEEccccccEEEEccHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHHHcccc //