[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31257.1
DDBJ      :             birA-like protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  332/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->232 2ewnB PDBj 6e-22 29.2 %
:RPS:PDB   18->248 2ejgA PDBj 1e-29 24.3 %
:RPS:SCOP  19->193 1wnlA2  d.104.1.2 * 8e-25 26.6 %
:HMM:SCOP  3->212 1biaA3 d.104.1.2 * 7.1e-45 27.3 %
:RPS:PFM   49->150 PF03099 * BPL_LplA_LipB 2e-07 37.6 %
:HMM:PFM   23->150 PF03099 * BPL_LplA_LipB 1.7e-17 27.3 121/125  
:HMM:PFM   210->233 PF02237 * BPL_C 3.3e-05 33.3 24/48  
:BLT:SWISS 10->232 BIRA_ECOLI 2e-21 29.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31257.1 GT:GENE ACD31257.1 GT:PRODUCT birA-like protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1535793..1536575 GB:FROM 1535793 GB:TO 1536575 GB:DIRECTION + GB:PRODUCT birA-like protein GB:PROTEIN_ID ACD31257.1 GB:DB_XREF GI:187712960 LENGTH 260 SQ:AASEQ MKNHRLIITQLNKYIDDIKVEYFPTIDSTNDYFLATNFTHKYHFCYVDKQTKGRGRRGDKWISEDKDNIYSTLAFHCDFAITADSLKSVKIALGVLAAIKKYIPKNLQQYLKIKLPNDIYFQDQKLAGILIETKNIKKDSFDIIIGVGINVNMTNTDENIDREWTSLSNINNKQLNSSRIIVDLVKSIIDSFDMNDATALAQLISYDYILDKRITFNYADQSYQGIAKGISEDLKLKIIDENNNYCEFELANINKIRVIK GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 10->232|BIRA_ECOLI|2e-21|29.2|219/321| BL:PDB:NREP 1 BL:PDB:REP 10->232|2ewnB|6e-22|29.2|219/317| RP:PDB:NREP 1 RP:PDB:REP 18->248|2ejgA|1e-29|24.3|210/232| RP:PFM:NREP 1 RP:PFM:REP 49->150|PF03099|2e-07|37.6|93/118|BPL_LplA_LipB| HM:PFM:NREP 2 HM:PFM:REP 23->150|PF03099|1.7e-17|27.3|121/125|BPL_LplA_LipB| HM:PFM:REP 210->233|PF02237|3.3e-05|33.3|24/48|BPL_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF03099|IPR004143| GO:PFM GO:0006464|"GO:protein modification process"|PF03099|IPR004143| RP:SCP:NREP 1 RP:SCP:REP 19->193|1wnlA2|8e-25|26.6|158/188|d.104.1.2| HM:SCP:REP 3->212|1biaA3|7.1e-45|27.3|205/207|d.104.1.2|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 366 OP:NHOMOORG 357 OP:PATTERN --1---111111111--------1--------1-----1111------------1-1---1------1 --1--------------------------------------------------------------------------------1111111-111111---1111-111----------------1-111-11-1------------------1------------------------------------1---1111111111111111--11-11111------------1-11111111111111111111---------1---------11--111-------11111111111111-------------1--111------111-------1--11--111--11---1-----1---11-------11-2-----11111-----------------------1-----------11--------------1----------1-----------------------------------------------------------------------------------------------------1---1---1--------11-------1-----------11---1--------11---------------------------11-1111111111111111111111111111--1---------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1111111111111111------1----1111111111111111112121222211111111111111-1----------1---11-111--------------1----------------------------1-------1- -------------------------------------------------------------------------------------------------------------2--------------------------------------------11----------------------------1-------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 96.2 SQ:SECSTR cEcHHHHccccccccTTcEEEEEEEEccHHHHHHHHccccTTEEEEEEEEccccccTTcccccccTTcEEEEEEEcccccGGGGGGHHHHHHHHHHHHHHHTTcccEEGccEEETTTEEEETTEEEEEEEEEEETTTEccTEEEEEEEEccccccccGcccTTcccHHHHHTccccHHHHHHHHHHHHHHHHHHHcTTHHHHHHHTTcccccEEEEcEcccccEEEEEEEcTTccEEEEcccccEEEEcc########## DISOP:02AL 260-261| PSIPRED cccHHHHHHHHHHHccccEEEEEEccccHHHHHHHcccccccEEEEEEccccccccccccEEcccccEEEEEEEEcccccHHHccHHHHHHHHHHHHHHHHHHHHccccccEEEcccEEEEccEEEEEEEEEEEEccccEEEEEEEEEEcccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEEEEEEcccccEEEEcccccEEEEEEEEEEEEEEcc //