[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31259.1
DDBJ      :             mechanosensitive ion channel protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.38.1d.58.43
:372 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  191->252 2oauA1  b.38.1.3 * 2e-05 19.3 %
:RPS:SCOP  267->370 2oauA2  d.58.43.1 * 7e-08 26.4 %
:HMM:SCOP  185->256 2oauA1 b.38.1.3 * 1.7e-09 31.3 %
:HMM:SCOP  257->374 2oauA2 d.58.43.1 * 1.9e-09 25.7 %
:RPS:PFM   145->361 PF00924 * MS_channel 1e-14 27.3 %
:HMM:PFM   143->363 PF00924 * MS_channel 8.4e-35 29.4 204/207  
:BLT:SWISS 191->370 YNAI_ECOLI 2e-17 28.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31259.1 GT:GENE ACD31259.1 GT:PRODUCT mechanosensitive ion channel protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1537500..1538618) GB:FROM 1537500 GB:TO 1538618 GB:DIRECTION - GB:PRODUCT mechanosensitive ion channel protein GB:PROTEIN_ID ACD31259.1 GB:DB_XREF GI:187712962 LENGTH 372 SQ:AASEQ MNLLNNILLRVENYSTTYILLIDFVICLVLSVIISLLGSLLVIKHKDTIRYSFVKSFKLTLYLVIWSYFIKTCVDLPVIVHLPDYKEVIVSYSDKIFDFCIYLAIIISLFRFLYKSKNIAIEKKKAETKDGYDDFRDINAIFKALELGAIVVSVILILAAFRVPLTALGAFSGVALAGLTLSQSTLLTNLFGGLFVVFNRKYSEGDIISSEINSTIKFSGTIKKIGTLTTRVDNSETAPMHIPNSVFLNTCITTTSRRTHRRIVQFITIDYKHIDKIPVIKQKLLEILKSHPNIDQNKTLAVSLASGGTNISGKLEGSFGSSGINIQIYAMVNKVFFSDFINVQDEIFINIAKELNDLDIEFAINPVTLHKY GT:EXON 1|1-372:0| BL:SWS:NREP 1 BL:SWS:REP 191->370|YNAI_ECOLI|2e-17|28.5|165/343| TM:NTM 5 TM:REGION 14->36| TM:REGION 58->80| TM:REGION 93->115| TM:REGION 135->157| TM:REGION 172->194| SEG 28->43|lvlsviisllgsllvi| SEG 175->190|alagltlsqstlltnl| SEG 253->262|tttsrrthrr| RP:PFM:NREP 1 RP:PFM:REP 145->361|PF00924|1e-14|27.3|198/203|MS_channel| HM:PFM:NREP 1 HM:PFM:REP 143->363|PF00924|8.4e-35|29.4|204/207|MS_channel| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00924|IPR006685| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00924|IPR006685| RP:SCP:NREP 2 RP:SCP:REP 191->252|2oauA1|2e-05|19.3|57/67|b.38.1.3| RP:SCP:REP 267->370|2oauA2|7e-08|26.4|87/101|d.58.43.1| HM:SCP:REP 185->256|2oauA1|1.7e-09|31.3|67/0|b.38.1.3|1/1|Sm-like ribonucleoproteins| HM:SCP:REP 257->374|2oauA2|1.9e-09|25.7|101/0|d.58.43.1|1/1|Mechanosensitive channel protein MscS (YggB), C-terminal domain| OP:NHOMO 100 OP:NHOMOORG 100 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------1---------------------------1---------------------------------1-111---------1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------1----1---------------------1----------------------------------------------1-------11-------------------------------------1------1111111111-1111111111111111111-------11111111111111111-111111---1---------------11111-----1111--------------------------------------------1111-11-111111-----11111--------------1---------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1---------------11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 372-373| PSIPRED ccHHHHHHHEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccccEEEEEEEEEEEEEEEEEcccccEEEEEcHHHcccEEEEEEcccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHcHHHHccccEEEEEEEccccccEEEEccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccc //