[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31266.1
DDBJ      :             peptidyl-prolyl cis-trans isomerase (PPIase)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  279/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.223.1d.26.1
:469 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   51->461 1m5yD PDBj 5e-25 22.8 %
:RPS:PDB   236->444 2bjrB PDBj 6e-17 11.9 %
:RPS:SCOP  51->228 1m5yA1  a.223.1.2 * 1e-19 18.5 %
:RPS:SCOP  203->306 1m5yA2  d.26.1.1 * 7e-06 14.2 %
:RPS:SCOP  314->418 1m5yA2  d.26.1.1 * 4e-10 20.0 %
:HMM:SCOP  51->232 1m5yA1 a.223.1.2 * 3.9e-31 29.2 %
:HMM:SCOP  201->306 1m5yA2 d.26.1.1 * 7.2e-12 24.0 %
:HMM:SCOP  314->421 1m5yA2 d.26.1.1 * 1.4e-12 27.9 %
:RPS:PFM   55->158 PF09312 * SurA_N 2e-09 34.6 %
:HMM:PFM   51->167 PF09312 * SurA_N 3.4e-23 26.5 117/118  
:HMM:PFM   210->299 PF00639 * Rotamase 1.7e-09 18.0 89/95  
:HMM:PFM   331->414 PF00639 * Rotamase 1.5e-06 30.4 79/95  
:BLT:SWISS 51->460 SURA_PHOLL 1e-32 27.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31266.1 GT:GENE ACD31266.1 GT:PRODUCT peptidyl-prolyl cis-trans isomerase (PPIase) GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1543386..1544795) GB:FROM 1543386 GB:TO 1544795 GB:DIRECTION - GB:PRODUCT peptidyl-prolyl cis-trans isomerase (PPIase) GB:PROTEIN_ID ACD31266.1 GB:DB_XREF GI:187712969 LENGTH 469 SQ:AASEQ MKKLITIFLLMLMLNNAYSDISSSMFQNAFNSGIDATSPVSMNVSDKKYLVNKTVAIVNSRPITSFELDQELAKLEAMQPNSAFNTDPLKLKRQALQDLISQSVLLQLAERNNIMISNQQLDSAIQDIAAKNGVSVESLKLNVEAAGMSFDSYKKRIRDQLMISQLQQQAIAQQVYVSPEEIQKYIKKHQKEFDREMSPVKLYTLKNLIVALPDSKKARQKKIDLFKKLALAVNDGSIDFSEIVKQFSQAPNAVSGGIVSQQVKFDSIPDIYKEYIKELKNHQVSQPFIVNHTLQMIYIDNIDEKAPILSKKITKYYVYAIEIKLDGGMNEDGAKSSLERAKLAIESGQEFTKVALKYNQDYDHPNGNFRWVSELDSPPSLPPAAFAQLKQLKENELSEPFQADGRTWMIIKYTKTKEYDAAEQLKEQKALEAIFSEKAQEIYKTWLTSMKDDAYIEILEDDLKTPELY GT:EXON 1|1-469:0| BL:SWS:NREP 1 BL:SWS:REP 51->460|SURA_PHOLL|1e-32|27.1|395/433| SEG 160->174|qlmisqlqqqaiaqq| BL:PDB:NREP 1 BL:PDB:REP 51->461|1m5yD|5e-25|22.8|381/389| RP:PDB:NREP 1 RP:PDB:REP 236->444|2bjrB|6e-17|11.9|201/350| RP:PFM:NREP 1 RP:PFM:REP 55->158|PF09312|2e-09|34.6|104/117|SurA_N| HM:PFM:NREP 3 HM:PFM:REP 51->167|PF09312|3.4e-23|26.5|117/118|SurA_N| HM:PFM:REP 210->299|PF00639|1.7e-09|18.0|89/95|Rotamase| HM:PFM:REP 331->414|PF00639|1.5e-06|30.4|79/95|Rotamase| RP:SCP:NREP 3 RP:SCP:REP 51->228|1m5yA1|1e-19|18.5|168/173|a.223.1.2| RP:SCP:REP 203->306|1m5yA2|7e-06|14.2|102/107|d.26.1.1| RP:SCP:REP 314->418|1m5yA2|4e-10|20.0|100/107|d.26.1.1| HM:SCP:REP 51->232|1m5yA1|3.9e-31|29.2|171/0|a.223.1.2|1/1|Triger factor/SurA peptide-binding domain-like| HM:SCP:REP 201->306|1m5yA2|7.2e-12|24.0|104/107|d.26.1.1|1/2|FKBP-like| HM:SCP:REP 314->421|1m5yA2|1.4e-12|27.9|104/107|d.26.1.1|2/2|FKBP-like| OP:NHOMO 283 OP:NHOMOORG 282 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1--------------------------1--------------------------------------------------------------------------1---1-1111111111111111111111111111111111111-1111111111--1111111-------11111111111111-1-1111111-21111--1---11-------------------------11111111111111111111111111111111---1-11---1111111111111111-111-1111111111111111111111111111111111111111111111111111-111111111111--11-----11111111-----1---------------11---111111111111111111111111111111111111111111111111111111111--1-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 409 STR:RPRED 87.2 SQ:SECSTR ##################################################cccEEEEEcccEEEHHHHHHHHHHHHHHTTTccc#ccHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHTTccHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHccccTTHHHHHHHcccccccccEE#cccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHEEEETTTTEEEEEETTEEEcGGGGTTEEEEEEccccccccccEEEEEETTccccTTcccccGGccccccTTcccccEEEEEEETTEEEEEEEcccEETTEEEEEEEETTEEEcccccEEEEEEcccTTTccEEEEEEEHHHHTcccEEccccHHHTcTTcccEEEEEEETTcEEEEEEEETTTEEEEETTEEEGGGGcEEEEEEcTTccHHHHHHHHHccEEEccc######## PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccEEccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHccccccccccHHHccHHHHHHHHHcccccccccEEccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccEEEccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcccccc //