[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31277.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:FETP_FRATM   RecName: Full=Probable Fe(2+)-trafficking protein;

Homologs  Archaea  0/68 : Bacteria  308/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.279.1
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->85 1yhdA PDBj 8e-19 46.3 %
:RPS:SCOP  4->75 1t07A  d.279.1.1 * 1e-23 47.2 %
:HMM:SCOP  1->89 1xs8A_ d.279.1.1 * 8.5e-29 47.2 %
:RPS:PFM   4->76 PF04362 * Iron_traffic 1e-16 50.7 %
:HMM:PFM   3->85 PF04362 * Iron_traffic 8.8e-38 53.0 83/88  
:BLT:SWISS 1->87 FETP_FRATM 4e-49 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31277.1 GT:GENE ACD31277.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1556140..1556403 GB:FROM 1556140 GB:TO 1556403 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31277.1 GB:DB_XREF GI:187712980 LENGTH 87 SQ:AASEQ MTKVFCKKYHQELDAIPFQPLPGELGKKIHNEISNKAWQAWLAHQTILINEYRLNLIETKAKEFLKEEMHKFLFEGKEEKPEQFSEI GT:EXON 1|1-87:0| SW:ID FETP_FRATM SW:DE RecName: Full=Probable Fe(2+)-trafficking protein; SW:GN OrderedLocusNames=FTM_1447; SW:KW Complete proteome; Iron. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->87|FETP_FRATM|4e-49|100.0|87/87| BL:PDB:NREP 1 BL:PDB:REP 4->85|1yhdA|8e-19|46.3|82/92| RP:PFM:NREP 1 RP:PFM:REP 4->76|PF04362|1e-16|50.7|73/88|Iron_traffic| HM:PFM:NREP 1 HM:PFM:REP 3->85|PF04362|8.8e-38|53.0|83/88|Iron_traffic| GO:PFM:NREP 1 GO:PFM GO:0005506|"GO:iron ion binding"|PF04362|IPR007457| RP:SCP:NREP 1 RP:SCP:REP 4->75|1t07A|1e-23|47.2|72/81|d.279.1.1| HM:SCP:REP 1->89|1xs8A_|8.5e-29|47.2|89/0|d.279.1.1|1/1|YggX-like| OP:NHOMO 308 OP:NHOMOORG 308 OP:PATTERN -------------------------------------------------------------------- 111-------------------------------------------------------------------------------------------------------------------------------------111------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111-11------------------------1111-1---------------------------1111111111111-1111111111111111111--11111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 96.6 SQ:SECSTR #ccEEccccccEEcccccccccTTHHHHHHHHccHHHHHHHHHHHHHHHHHTTccTTcHHHHHHHHHHHHHHTTTTTcccccccc## DISOP:02AL 87-88| PSIPRED ccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccc //