[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31288.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:347 amino acids
:PSIPRED
:RPS:PFM   10->170 PF04632 * FUSC 1e-08 36.0 %
:HMM:PFM   16->221 PF04632 * FUSC 9.9e-27 26.8 198/650  
:BLT:SWISS 58->231 MDTO_ECOLI 6e-04 24.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31288.1 GT:GENE ACD31288.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1573711..1574754) GB:FROM 1573711 GB:TO 1574754 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31288.1 GB:DB_XREF GI:187712991 LENGTH 347 SQ:AASEQ MQFAFLNSNKYAAINAFKACIAIVIAYLVGSFLGRIFGIERMYLWMSVTVMVVMSTQPNLGGAVDKALMRFLGTVIGAVIAIIIVACVKNYIHEFLLILPFIFLAVYFAGATKYSYAGTLAGITLIIIMFNQQPGVQVAIYRAVEISLGIIISLIVNRFILPIRAETRLKESYSKTIAQIHDFFNILFIERNESHDKLRENIFHEFPKHLALIKELKYEKTAKQVQEFEKISLYIRRLYRYMIVMYEYIEFFLDKPTIAKLDKEPAFIEFKKYIMKSLDNVSNDIKKTKRISYKELLRFERHILPLLNEVEVLNYKDESFIFYIKMFLDALKKLALEHNYILKISKH GT:EXON 1|1-347:0| BL:SWS:NREP 1 BL:SWS:REP 58->231|MDTO_ECOLI|6e-04|24.6|171/683| TM:NTM 5 TM:REGION 14->36| TM:REGION 40->62| TM:REGION 79->101| TM:REGION 116->138| TM:REGION 143->165| SEG 46->56|msvtvmvvmst| SEG 75->86|vigaviaiiiva| RP:PFM:NREP 1 RP:PFM:REP 10->170|PF04632|1e-08|36.0|150/515|FUSC| HM:PFM:NREP 1 HM:PFM:REP 16->221|PF04632|9.9e-27|26.8|198/650|FUSC| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1111---1111-1--11-----------------------------------------------------------------------------------------------------111111----------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHEEEccc //