[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31291.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 56->147 RUVA_MYCS5 7e-06 33.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31291.1 GT:GENE ACD31291.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1578396..1579112) GB:FROM 1578396 GB:TO 1579112 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31291.1 GB:DB_XREF GI:187712994 LENGTH 238 SQ:AASEQ MKIARYKKGFIKASEYNSKLHFDNIFCPDCGKAKVKIVRKADQEPYFVFVQDQLHDELCPRVAKPIQDQKIKELILSDSKKDISKLNYLVNKNLEKCINLVTKLENNGELKKADELNLMPQKKQQITEKRIKEYAKQDIYTINIVDLSDIDTQQLNNKYCLIYGVAGITLADVGDSKKLFFKADQDSRFSLFVVPSQIKYLDFDKGKRAKFAVFGRFKKVGKFINLEIRSTRDLVIRD GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 56->147|RUVA_MYCS5|7e-06|33.7|92/198| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 95-95,109-109,157-157,160-160,165-165,171-171,179-179,207-207,213-214,216-216,221-221| PSIPRED cccHHHHHccEEHHcccccccccccccccccccEEEEEEEcccccEEEEEHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEHHHccHHHccccEEEEEEEccEEEEEcccccEEEEEEccccEEEEEEEcccEEEEEcccccEEEEEHHHHHHHHHcEEEEEEEcccEEEEcc //