[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31297.1
DDBJ      :             conserved hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  392/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:258 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->244 PF01925 * TauE 1e-11 28.1 %
:HMM:PFM   18->249 PF01925 * TauE 1.7e-35 24.3 230/239  
:BLT:SWISS 12->243 Y198_HAEIN 4e-45 39.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31297.1 GT:GENE ACD31297.1 GT:PRODUCT conserved hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1585213..1585989) GB:FROM 1585213 GB:TO 1585989 GB:DIRECTION - GB:PRODUCT conserved hypothetical membrane protein GB:PROTEIN_ID ACD31297.1 GB:DB_XREF GI:187713000 LENGTH 258 SQ:AASEQ MQHFFAEHFYILCVFIVSMGFLASFIDAIAGGGGLISIPALSLTGLPIVTVLGTNKFQASIGTGMAVLKYYKSGLIDIKIVVRGLVAGFIGACCGTLLTLLIHNDFMNNIVSILLIAVFIFSIVNKNLGVAQGKKRMSEVAFFTLFGFILGAYDGFFGPGTGNLWIIAIVYFLGYTFLQASGYAKMLNLKSNVFSLTVFALSGQVNIAFGLLMALGSFFGGIAGSRMVILKGSKLVRPIFIIVVGASILLMIKTRYFS GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 12->243|Y198_HAEIN|4e-45|39.7|232/255| TM:NTM 8 TM:REGION 6->28| TM:REGION 33->55| TM:REGION 78->100| TM:REGION 108->130| TM:REGION 137->159| TM:REGION 161->183| TM:REGION 197->219| TM:REGION 230->252| RP:PFM:NREP 1 RP:PFM:REP 15->244|PF01925|1e-11|28.1|228/237|TauE| HM:PFM:NREP 1 HM:PFM:REP 18->249|PF01925|1.7e-35|24.3|230/239|TauE| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF01925|IPR002781| OP:NHOMO 469 OP:NHOMOORG 392 OP:PATTERN -------------------------------------------------------------------- -1---111---11-1---------------------1111----1111111-1111-1----11--1--11--------1-1-----------------1-1------------------------------------------1------------111--1--------1--------1--111----11--222223221222332-1----222---1---------1-11111111111111111111-----------------1--------------------------------------------------------1111-11-111-1-------1--------11----1---22---1----111-------1-----------11111111111-11-11-1--1--1111111--111-------1-----1-11111111----1----------------------------------1--------------------------------1111-11111121111112-111----111111--1---111-11-1---1------1-1---11-11111---11111111111-2--------1---11111---2--122222222322222222223--1---1------11111121111111111-1111111111111111111111222111111111111111111111-11111-111111111111-----------------21111111111-1111111-1111111-111121111233311111--1111---211222222222321111111----------1--------------1---------------------------21-2211111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 258-259| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc //