[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31300.1
DDBJ      :             DNA-directed RNA polymerase, alpha subunit/40 kD subunit
Swiss-Prot:RPOA2_FRATW  RecName: Full=DNA-directed RNA polymerase subunit alpha 2;         Short=RNAP subunit alpha 2;         EC=2.7.7.6;AltName: Full=Transcriptase subunit alpha 2;AltName: Full=RNA polymerase subunit alpha 2;

Homologs  Archaea  0/68 : Bacteria  910/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.60.3d.74.3
:318 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->226 1bdfC PDBj 1e-28 32.7 %
:BLT:PDB   243->315 1cooA PDBj 5e-23 65.8 %
:RPS:PDB   3->228 3dxjA PDBj 1e-35 34.1 %
:RPS:PDB   243->315 1cooA PDBj 6e-10 65.8 %
:RPS:SCOP  124->224 1bdfA1  d.74.3.1 * 2e-17 30.9 %
:RPS:SCOP  251->307 1doqA  a.60.3.1 * 5e-14 35.1 %
:HMM:SCOP  2->227 1iw7A1 d.74.3.1 * 4.8e-22 40.2 %
:HMM:SCOP  242->318 1cooA_ a.60.3.1 * 3.9e-22 50.6 %
:RPS:PFM   27->225 PF01193 * RNA_pol_L 2e-12 34.9 %
:RPS:PFM   236->300 PF03118 * RNA_pol_A_CTD 8e-11 52.3 %
:HMM:PFM   240->302 PF03118 * RNA_pol_A_CTD 3.2e-26 50.8 63/67  
:HMM:PFM   28->223 PF01193 * RNA_pol_L 2.7e-14 32.9 82/86  
:BLT:SWISS 1->318 RPOA2_FRATW e-179 99.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31300.1 GT:GENE ACD31300.1 GT:PRODUCT DNA-directed RNA polymerase, alpha subunit/40 kD subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1589977..1590933) GB:FROM 1589977 GB:TO 1590933 GB:DIRECTION - GB:PRODUCT DNA-directed RNA polymerase, alpha subunit/40 kD subunit GB:PROTEIN_ID ACD31300.1 GB:DB_XREF GI:187713003 LENGTH 318 SQ:AASEQ MALENLLHPTNIKIDEYAKNATKFSFEALERGVGYTLGFALKQTMLYSIAGACVTSIKINDGKVTSLEDVIPCDETVADIILNVKSLPVTLTEGVETGTITFELSGSEEEIFSEEAKLSEGLAITEEVFICSYNGGKKLKIEAKVEKGVGFRPAQDNFKDGEFLLDATFSPVVFCDFEIKDARVGRRTDLDKLELNIKTNGNVNCEEALRLAATKIQNQLRNIVDIEEINKGIFVEDPTKDINPILLKHAEELNLTARSSNCLKAVNIRLIGELVQKTENELLKAPNFGKKSLTEIKDKLSELGLSLGTLIENWPQDL GT:EXON 1|1-318:0| SW:ID RPOA2_FRATW SW:DE RecName: Full=DNA-directed RNA polymerase subunit alpha 2; Short=RNAP subunit alpha 2; EC=2.7.7.6;AltName: Full=Transcriptase subunit alpha 2;AltName: Full=RNA polymerase subunit alpha 2; SW:GN Name=rpoA2; OrderedLocusNames=FTW_0446; SW:KW Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->318|RPOA2_FRATW|e-179|99.4|318/318| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 2 BL:PDB:REP 2->226|1bdfC|1e-28|32.7|223/228| BL:PDB:REP 243->315|1cooA|5e-23|65.8|73/81| RP:PDB:NREP 2 RP:PDB:REP 3->228|3dxjA|1e-35|34.1|223/231| RP:PDB:REP 243->315|1cooA|6e-10|65.8|73/81| RP:PFM:NREP 2 RP:PFM:REP 27->225|PF01193|2e-12|34.9|195/207|RNA_pol_L| RP:PFM:REP 236->300|PF03118|8e-11|52.3|65/67|RNA_pol_A_CTD| HM:PFM:NREP 2 HM:PFM:REP 240->302|PF03118|3.2e-26|50.8|63/67|RNA_pol_A_CTD| HM:PFM:REP 28->223|PF01193|2.7e-14|32.9|82/86|RNA_pol_L| GO:PFM:NREP 6 GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF01193|IPR011261| GO:PFM GO:0006350|"GO:transcription"|PF01193|IPR011261| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF01193|IPR011261| GO:PFM GO:0003677|"GO:DNA binding"|PF03118|IPR011260| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF03118|IPR011260| GO:PFM GO:0006350|"GO:transcription"|PF03118|IPR011260| RP:SCP:NREP 2 RP:SCP:REP 124->224|1bdfA1|2e-17|30.9|97/105|d.74.3.1| RP:SCP:REP 251->307|1doqA|5e-14|35.1|57/69|a.60.3.1| HM:SCP:REP 2->227|1iw7A1|4.8e-22|40.2|107/107|d.74.3.1|1/1|RBP11-like subunits of RNA polymerase| HM:SCP:REP 242->318|1cooA_|3.9e-22|50.6|77/0|a.60.3.1|1/1|C-terminal domain of RNA polymerase alpha subunit| OP:NHOMO 932 OP:NHOMOORG 914 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222222221111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1---------21------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 98.4 SQ:SECSTR #cccccccccEEEEEEccccEEEEEEEEEcTTHHHHHHHHHHHHHHTTcEEEEEEEEEETTcccccTTcccTTcccHHHHHHHHHTccEEEcccTTccEEEEEEEEccEEEcGGGccccTTEEEcTTcccEEEcTTccEEEEEEEEEEEcEEcTTTccccTcEEccEEcccEEEEEEEEcccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHTTccccc#ccccGGGGGccTTHHHHHHHHTcTTccHHHHHHHHHTTcccHHHHHHHccccHHHcTHHHHHTTTGGHHHHHHHccccTccccccc### PSIPRED ccHHHcccccEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccHHHHHHHcccEEEEEEccccEEEEEEEEEccEEEEEcccccccccEEEccccEEEEEccccEEEEEEEEEcccccccccccccccEEEEccccccEEEEEEEEEEEEcccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHcccHHHccccHHHHHHHHHcccccHHHHHHccHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccc //