[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31373.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   51->112 PF07264 * EI24 0.00031 25.8 62/264  
:HMM:PFM   124->148 PF04193 * PQ-loop 0.001 16.0 25/61  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31373.1 GT:GENE ACD31373.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1664414..1664896) GB:FROM 1664414 GB:TO 1664896 GB:DIRECTION - GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD31373.1 GB:DB_XREF GI:187713076 LENGTH 160 SQ:AASEQ MEKDWKYYLGILLFILSFVPYILVFVIMPFLGLSTSSYLAASSILLISAEAIFLVSVMLLGRAIIDAIKAAIKKVFKSAFTNQKPISYTRHSIGLIMFFASLVYPTLLLEMILIFDKINQVGQLNMMLILFSGDIIFIASFFVLGGDFISKLKSLFKYQK GT:EXON 1|1-160:0| TM:NTM 4 TM:REGION 9->31| TM:REGION 44->66| TM:REGION 94->116| TM:REGION 129->151| SEG 31->54|lglstssylaassillisaeaifl| SEG 63->74|aiidaikaaikk| HM:PFM:NREP 2 HM:PFM:REP 51->112|PF07264|0.00031|25.8|62/264|EI24| HM:PFM:REP 124->148|PF04193|0.001|16.0|25/61|PQ-loop| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 26-46,160-161| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //