[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31379.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->54 PF12270 * Cyt_c_ox_IV 2e-04 51.5 %
:HMM:PFM   87->134 PF09127 * Leuk-A4-hydro_C 1.3e-05 22.9 48/143  
:HMM:PFM   26->57 PF06936 * Selenoprotein_S 0.00013 31.2 32/190  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31379.1 GT:GENE ACD31379.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1670016..1670492) GB:FROM 1670016 GB:TO 1670492 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31379.1 GB:DB_XREF GI:187713082 LENGTH 158 SQ:AASEQ MQTNNLLEQLKDIYLPEKVSQWWPLAYGWWLLLAVVIFAIIVGLVFLHLRRKAKSYKDCIIDDFRETVEKIYQQKPKEVLQDISVYLKRVALQKFPNQPIKTLHGQQWLEFLDTKLKQQSFKTTKANMLGNSYKPVELDRVTLNEIMTVAEQWLRRVL GT:EXON 1|1-158:0| TM:NTM 1 TM:REGION 25->47| RP:PFM:NREP 1 RP:PFM:REP 22->54|PF12270|2e-04|51.5|33/134|Cyt_c_ox_IV| HM:PFM:NREP 2 HM:PFM:REP 87->134|PF09127|1.3e-05|22.9|48/143|Leuk-A4-hydro_C| HM:PFM:REP 26->57|PF06936|0.00013|31.2|32/190|Selenoprotein_S| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1----------------------------------------------------------------------------------------------------------------------11-1-------------------------------------------------111111111----1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 158-159| PSIPRED ccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHcccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHc //