[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31384.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->178 3cixA PDBj 7e-05 14.9 %
:BLT:SWISS 18->179 Y550_METJA 1e-08 32.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31384.1 GT:GENE ACD31384.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1673800..1674495 GB:FROM 1673800 GB:TO 1674495 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31384.1 GB:DB_XREF GI:187713087 LENGTH 231 SQ:AASEQ MDRYSKITNVHMYKREIVLLKSRPCAYGKCTFCDYILDNSRNIDEINAVNFEVLANVTGEFGILEVINSGNVFELPQATKQRIKEIIKQKNIKLLFVEAHWMYKDHLHKIKDIFETDIFIKTGLESFDNDFREKLLNKSFYHDSPAQLSQLFDSVCLLIGVKGQTKEIIKRDIEIAKKYFKHTTLNLYVNNTTTIKADEELKSWFLEEYKELFKDPQFEILVSNTDFGVGD GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 18->179|Y550_METJA|1e-08|32.8|137/100| SEG 183->194|ttlnlyvnnttt| RP:PDB:NREP 1 RP:PDB:REP 1->178|3cixA|7e-05|14.9|174/345| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--1111----1--------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 92.2 SQ:SECSTR HHHHHHHHHHHHccEEEEEEEEccccc#ccTTcTTcTTccccccccccHHHHHHHHHHHTTccEEEEEEcccGGGTTHHHHHHHHHHHTTcccEEEEEcccccHHHHHHHHHTTccEEEcHTccccccHHHHHHHcTTccHHHHHHHHHHHEEEEccEEccTTccHHHHHHHHHHHHHccccccccccccc#####HHHHHHHHHHHHHHHHcTTTccH############ DISOP:02AL 231-232| PSIPRED ccccccccccccccEEEEEEEEcccccEEEEccccccccccHHHHHHHHHHHHHHHccccccEEEEEEccccEEccHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHccEEEEEEEEccccHHHHHHHcccccccccHHHHHHHccEEEEEEEcccHHHHHHHHHHHHHHcccEEEEEEEEEEcccEEEEHHHHHHHHHHHHHccccccEEEEEEEcccccccc //