[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31395.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
:322 amino acids
:PSIPRED
:RPS:PFM   140->297 PF05686 * DUF821 9e-20 35.5 %
:HMM:PFM   149->296 PF05686 * DUF821 2.5e-23 27.9 147/396  
:BLT:SWISS 3->317 LPSA_DICNO 8e-72 46.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31395.1 GT:GENE ACD31395.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1690304..1691272) GB:FROM 1690304 GB:TO 1691272 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31395.1 GB:DB_XREF GI:187713098 LENGTH 322 SQ:AASEQ MKKLKYYIKNISRTIIPKKFFELSLEHKLKSIAKFDKEYIEYRVNYYNRLSKPFMLQNSSNWKNFKRNTPVFDIIDHSLVRKSINSSYFYDFKEFLVYFNKTDSFATAFYDLTKIPQQPTFVKSRPIADDNQNSIILKLDKLRHFSLFEDNQKFEDKLNMAVFRGACHQPTRQYFIENYYNLPNTNFGDTRKESLGQPYNKGFLSIQDQLKYKYIVSIEGYDVATNLKWIMNSNSLCFMNKPKYETWFMEGTLIPNHHYVLLKDDYSDLQEKIDYYNNHPEKALKIIKNANEYVNQFKNKQREELISLLVMKKYFGLNKTSH GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 3->317|LPSA_DICNO|8e-72|46.0|300/318| RP:PFM:NREP 1 RP:PFM:REP 140->297|PF05686|9e-20|35.5|155/233|DUF821| HM:PFM:NREP 1 HM:PFM:REP 149->296|PF05686|2.5e-23|27.9|147/396|DUF821| OP:NHOMO 44 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------111-----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------111-1-1----------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---1------111--------------------------------------------------------------------------- ---------------1--------------------------------------------------------------------------------------------3----------------------------------------------11----------------1------------------A1---1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHccHHHEEEEEccccccccccccEEEcccccccccccHHHHHHHHHHHHHHcccccHHHcccEEEEEcccccHHHHHHHHHHHccccccccEEcccccccccccccccHHHHHHHHHcccccccEEHHHHHHHHccccEEEEEcccHHEEcccccccccEEEEEEcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccc //