[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31397.1
DDBJ      :             acarboxylesterase/phospholipase family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  208/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:217 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->213 1fj2A PDBj 4e-41 42.9 %
:RPS:PDB   8->216 3dohB PDBj 4e-13 18.5 %
:RPS:SCOP  2->214 1fj2A  c.69.1.14 * 8e-65 42.3 %
:HMM:SCOP  4->216 1fj2A_ c.69.1.14 * 2.2e-39 27.7 %
:RPS:PFM   11->211 PF02230 * Abhydrolase_2 3e-34 41.9 %
:HMM:PFM   2->214 PF02230 * Abhydrolase_2 4.6e-66 42.3 208/216  
:BLT:SWISS 4->213 LYPA1_BOVIN 9e-43 44.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31397.1 GT:GENE ACD31397.1 GT:PRODUCT acarboxylesterase/phospholipase family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1693664..1694317 GB:FROM 1693664 GB:TO 1694317 GB:DIRECTION + GB:PRODUCT acarboxylesterase/phospholipase family protein GB:PROTEIN_ID ACD31397.1 GB:DB_XREF GI:187713100 LENGTH 217 SQ:AASEQ MEPAKQARFCVIWLHGLGADGHDFVDIVNYFDVSLDEIRFIFPHADIIPVTINMGMQMRAWYDIKSLDANSLNRVVDVEGINSSIAKVNKLIDSQVNQGIASENIILAGFSQGGIIATYTAITSQRKLGGIMALSTYLPAWDNFKGKITSINKGLPILVCHGTDDQVLPEVLGHDLSDKLKVNGFANEYKHYVGMQHSVCMEEIKDISNFIAKTFKI GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 4->213|LYPA1_BOVIN|9e-43|44.4|205/230| BL:PDB:NREP 1 BL:PDB:REP 4->213|1fj2A|4e-41|42.9|205/229| RP:PDB:NREP 1 RP:PDB:REP 8->216|3dohB|4e-13|18.5|195/373| RP:PFM:NREP 1 RP:PFM:REP 11->211|PF02230|3e-34|41.9|191/206|Abhydrolase_2| HM:PFM:NREP 1 HM:PFM:REP 2->214|PF02230|4.6e-66|42.3|208/216|Abhydrolase_2| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF02230|IPR003140| RP:SCP:NREP 1 RP:SCP:REP 2->214|1fj2A|8e-65|42.3|208/229|c.69.1.14| HM:SCP:REP 4->216|1fj2A_|2.2e-39|27.7|206/0|c.69.1.14|1/1|alpha/beta-Hydrolases| OP:NHOMO 648 OP:NHOMOORG 397 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------11----1--------------------1-1-1-11---11------1--11-11--------11--1111---1-----1--11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------21-------------------------1--1----1----1----11---1--11-------11--------111-----11111-----1111111111111111111------11111------11111--1-111111--1111111---11----1111-111-111---------111-111--------------------------------------------------------111--111111111211111111111111111--1-212--------------------------------------------------------------------------------------------1111111111-1111---2-----------------11111-111111111111111211111111111---1----------11111111111111------1111------------------------------------------------- --2223--111-11123211111111111111111111111111111222111112122111111111111111111--111111111-21132211111241233-1353453344322223363181FQ3-7672222313731324232232432311112212432311221111J1112225663472341224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 100.0 SQ:SECSTR EcTTcccEEEEEEEcccTTccccccHHHHHHHHHcccTTTGGGcHHHHTTcccEEEEEcccTTccccTTTTcccccccHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEETHHHHHHHHHHHHcTTTccEEEEEcccccGGGGGGGTTcTGcTTccEEEEEETTcccccTHHHHHHHHHHHHTTccEEEEEEcTTHHHHHHHTcHHHHHHHHTcccc PSIPRED ccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEcHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHccc //