[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31401.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   141->176 PF01123 * Stap_Strp_toxin 0.00044 25.0 36/88  
:PROS 104->134|PS00107|PROTEIN_KINASE_ATP
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31401.1 GT:GENE ACD31401.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1696156..1696725 GB:FROM 1696156 GB:TO 1696725 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD31401.1 GB:DB_XREF GI:187713104 LENGTH 189 SQ:AASEQ MQKYSPLILSLLLISCSSNPEITRIGPGIIKSQQQLISKEQLKKDETKKDVLTGAGIGAGSGAMAGAMIGGVIGIIGGGICTIITLGLGAVPCFAGTVGGGMALGAGVGAGTGALVGAGGGYIYVSNKDDIIGKYKYEVLEDGKTSPITFEQFPDRNYLAGQKVDIYTSKYKGEKTYFIKAIQQDSKED GT:EXON 1|1-189:0| PROS 104->134|PS00107|PROTEIN_KINASE_ATP|PDOC00100| SEG 5->18|splilsllliscss| SEG 54->90|gagigagsgamagamiggvigiigggictiitlglga| SEG 95->121|agtvgggmalgagvgagtgalvgaggg| HM:PFM:NREP 1 HM:PFM:REP 141->176|PF01123|0.00044|25.0|36/88|Stap_Strp_toxin| OP:NHOMO 10 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111121-21---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-31,39-39,45-48,52-53,125-143,189-190| PSIPRED cccHHHHHHHHHHHHcccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccEEHHEEHHHHHccccccccHHHccccccccccEEEEEEEcccccHHHHHHHHHHHHccc //