[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31409.1
DDBJ      :             cytochrome b561 family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.21.1
:171 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->159 1kqfC_ f.21.1.1 * 1.6e-12 23.9 %
:HMM:PFM   7->161 PF01292 * Ni_hydr_CYTB 7.3e-19 23.0 148/182  
:BLT:SWISS 4->164 C56H_ECOLI 3e-13 26.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31409.1 GT:GENE ACD31409.1 GT:PRODUCT cytochrome b561 family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1707223..1707738) GB:FROM 1707223 GB:TO 1707738 GB:DIRECTION - GB:PRODUCT cytochrome b561 family protein GB:PROTEIN_ID ACD31409.1 GB:DB_XREF GI:187713112 LENGTH 171 SQ:AASEQ MQTKINKLMVSIHWATVILIILAFISIEFRSTFGKETLFHDVMKTSHLYIGFLVLFLTILRLVVRKFVEFPIIGQRLSYNKFREIVAKIVHGFLYIWLITMPILGWCIISAKGTYTIPFGLSSITPVLAKVYVVKIKDIHEIFAYISLAVIFLHATVAISEYYILRLRSEK GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 4->164|C56H_ECOLI|3e-13|26.6|158/176| TM:NTM 5 TM:REGION 7->28| TM:REGION 50->72| TM:REGION 86->108| TM:REGION 116->135| TM:REGION 142->164| HM:PFM:NREP 1 HM:PFM:REP 7->161|PF01292|7.3e-19|23.0|148/182|Ni_hydr_CYTB| HM:SCP:REP 1->159|1kqfC_|1.6e-12|23.9|155/0|f.21.1.1|1/1|Transmembrane di-heme cytochromes| OP:NHOMO 71 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------1--------------------------------------------------------------------------------11-------------------1-1----1-2--1----1--------------------------------------------------------------------------------11--1---------111------------------------11--111-1---11-11111-11--1--111111---11---111-1211111-1----1------------1----11---------------------------------------------------1111---111--1--11111----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 171-172| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //