[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31410.1
DDBJ      :             inorganic phosphate transporter (PiT) family protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  584/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
:331 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->161,168->311 PF01384 * PHO4 5e-22 37.5 %
:HMM:PFM   20->316 PF01384 * PHO4 3.2e-95 39.1 297/319  
:BLT:SWISS 17->328 PIT_BACSU 2e-59 39.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31410.1 GT:GENE ACD31410.1 GT:PRODUCT inorganic phosphate transporter (PiT) family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1707819..1708814) GB:FROM 1707819 GB:TO 1708814 GB:DIRECTION - GB:PRODUCT inorganic phosphate transporter (PiT) family protein GB:PROTEIN_ID ACD31410.1 GB:DB_XREF GI:187713113 LENGTH 331 SQ:AASEQ MISSVLIAIIVIALFFEFTNGFHDAANVVATPIATKSLTPYQAIALAAFFNFLGAFFGTAVAATISKGLVDTNVVTDIVLISALLGAISWNFFTWSFGIPSSSSHALIGSLVGAVIISSSYQNVSYMTVVNKVLIPMVTSPVIAFFLALIICIVLLNIFMRFFRVRTTNKYIREMQVLSTSLLSFSHGSNDAQKTMSIITLALLSAGLVKTTQVPDWVIILCGVAMGLGTLSGGKKIIKTLSAKLSKLEPVNAVSAELSSGILVLGASHIGLPVSTTQVASGSIMGAGYADAGVNWKVVKKMAMAWILTIPACVFVTSAIYTVIYYIFGSF GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 17->328|PIT_BACSU|2e-59|39.0|310/333| TM:NTM 8 TM:REGION 8->30| TM:REGION 44->66| TM:REGION 72->94| TM:REGION 105->127| TM:REGION 138->160| TM:REGION 202->224| TM:REGION 254->276| TM:REGION 304->326| SEG 2->16|issvliaiivialff| SEG 43->58|aialaaffnflgaffg| RP:PFM:NREP 1 RP:PFM:REP 21->161,168->311|PF01384|5e-22|37.5|284/375|PHO4| HM:PFM:NREP 1 HM:PFM:REP 20->316|PF01384|3.2e-95|39.1|297/319|PHO4| GO:PFM:NREP 3 GO:PFM GO:0005315|"GO:inorganic phosphate transmembrane transporter activity"|PF01384|IPR001204| GO:PFM GO:0006817|"GO:phosphate transport"|PF01384|IPR001204| GO:PFM GO:0016020|"GO:membrane"|PF01384|IPR001204| OP:NHOMO 1150 OP:NHOMOORG 770 OP:PATTERN ----1--1---------------2----------1111-----21112-11-112213132------- -22-211111121121122-2111212222211111121111--211112212222-3--11111--2221----1112122--------111------1-11--1-1-1-11111111-11111----------------111--1--1-----11--------1-111-------------111----12-2111111211112111--22111111112-1-22222221111111111111111111111---------------------------------------------------------------------1--11-------1-11-11-111--1-----1-111111--11--11---1--1--1-----1122211111111------------1111111212--3222222233221--1-1-11111-2111111111-11-111--------------------------------121-111112222222222122222222124211111112111111111111-113--1-1-1111111---112---1---112-11111111111-1111112212111211111111111111111111--221-111111-12222111222212112211----1111-11111112112222222222-2222222222222222221111111111111111111111111211222121111111111111111-11111-2222111-111111111111111111111111112-3333222212221-2221111111111111111111111111111111111----1-1-------------------------------------------1123321222-3- -1----1-A42---11234333341431111-12111111-11112111-444435211111111-1211--11111111-11111------231-111-1-131--241432344412222213322-2B2-223112222222122-221-42122321K211111112761-1A5-3211243123222111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 330-332| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //