[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31420.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31420.1 GT:GENE ACD31420.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1724464..1724922 GB:FROM 1724464 GB:TO 1724922 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31420.1 GB:DB_XREF GI:187713123 LENGTH 152 SQ:AASEQ MKKISMLLICGLCFATGFGDEITTNNLSTQSNSGSSLATSTATVKTKMPKPSDHATPMAMNATPTPLGKDIREGNIPTIDQPKQHQQLVGSDPSTWTPAYLQVKKFKKCLSTENYRGWQGYCFPAEQPKECPDESWDELSKMNLIPCTNTSK GT:EXON 1|1-152:0| TM:NTM 1 TM:REGION 4->22| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-45,48-48,53-53,101-113,115-116| PSIPRED cccHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEcccccccccccEEcccccccccHHHHHccccccccHHHHHHHHccccccccHHHEEHHHHHHHHEEccccccHHEEcccccccccccccHHHHHcccEEEcccccc //