[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31423.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y177_FRATH   RecName: Full=UPF0161 protein FTL_0177;

Homologs  Archaea  0/68 : Bacteria  608/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:RPS:PFM   12->71 PF01809 * DUF37 5e-14 55.0 %
:HMM:PFM   11->70 PF01809 * DUF37 1.5e-30 58.3 60/68  
:BLT:SWISS 1->82 Y177_FRATH 3e-47 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31423.1 GT:GENE ACD31423.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1725467..1725715 GB:FROM 1725467 GB:TO 1725715 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31423.1 GB:DB_XREF GI:187713126 LENGTH 82 SQ:AASEQ MFFKKITLIPFVMLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTTRRLLRCHPLSKRDYYDLVPCKNKKG GT:EXON 1|1-82:0| SW:ID Y177_FRATH SW:DE RecName: Full=UPF0161 protein FTL_0177; SW:GN OrderedLocusNames=FTL_0177; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->82|Y177_FRATH|3e-47|100.0|82/82| TM:NTM 1 TM:REGION 6->28| RP:PFM:NREP 1 RP:PFM:REP 12->71|PF01809|5e-14|55.0|60/68|DUF37| HM:PFM:NREP 1 HM:PFM:REP 11->70|PF01809|1.5e-30|58.3|60/68|DUF37| OP:NHOMO 647 OP:NHOMOORG 629 OP:PATTERN -------------------------------------------------------------------- 111------------1112-11--111111111111-1111---1111-111111-1111-11-1111111----1-11111111111111111111--111111111111111111111111111111111111111111----131111111111111-111111111111111111111111111111-111111111111111111122111-111-11-111111111-111111111111-1111111-1-11--11111--11111---111111-111111-111----1--1111111111111---1111111111111111111-1-111111111-1111111-1-1--1111-1111-1211-11111--1-1--11---1--------------------------1--------------1---1111111111--------1-1-11-1--------11--11111-111-111----111-1-111111111111111111111111111111111111111111111111-1111111111111111111111-111-1111-111----111111111111-----1-------1--------------11111-1111111111111111111111-1111-1-1-11-------11-1-1---11---1--11---1111-111111111----111--11--1---1-1-1-11-1---11-----111-1-11-111--1--111-11-111111-1-111111111111111111-1--1-1-1-11-1-1111111111--11----1-1-1--1--1111111-1--1-11111111111--------1---------------------------111--1111111- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------4---111116111111231-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //